# PaCkAgE DaTaStReAm pcxx 1 773 # end of header 0707010005b112000081a4000000000000000100000001364c8fee00000099000000ad0000000400000000000000000000000d00000004pcxx/pkginfoPKG=pcxx NAME=Digi, Intl. Async Driver Package ARCH=i386 VERSION=1.4.0 CATEGORY=system,utilities CLASS=none build PSTAMP=ews219981113140046 CLASSES=none 0707010005b111000081a4000000000000000100000001364c8f72000004da000000ad0000000400000000000000000000000c00000004pcxx/pkgmap: 1 773 1 d none /tmp ? ? ? 1 d none /tmp/pcxx 0700 root root 1 f none /tmp/pcxx/ditty 0755 bin bin 26140 11435 910987005 1 f none /tmp/pcxx/ditty.1 0644 root root 7153 19551 910380713 1 f none /tmp/pcxx/dpa 0755 bin bin 140788 6474 910986836 1 f none /tmp/pcxx/dpa_info 0444 bin bin 284 23680 910380714 1 f none /tmp/pcxx/dpa_info1 0444 bin bin 2427 55241 910380714 1 f none /tmp/pcxx/dpa_info2 0444 bin bin 828 3376 910380714 1 f none /tmp/pcxx/dpa_info3 0444 bin bin 546 47487 910380714 1 f none /tmp/pcxx/dpa_info4 0444 bin bin 4051 42469 910380714 1 f none /tmp/pcxx/dpa_info5 0444 bin bin 2843 18593 910380714 1 f none /tmp/pcxx/dpa_info6 0444 bin bin 490 38968 910380714 1 f none /tmp/pcxx/dpa_info7 0444 bin bin 7585 36245 910380714 1 v none /tmp/pcxx/pcxx 0777 root root 112300 14540 910986969 1 v none /tmp/pcxx/pcxxconfig 0777 root root 7876 26444 910380715 1 v none /tmp/pcxx/pcxxdl 0777 root root 6884 52887 910986986 1 v none /tmp/pcxx/pcxxmknod 0777 root root 8236 33972 910380715 1 f none /tmp/pcxx/stdigi.h 0644 root root 8175 11575 910380718 1 d none /usr ? ? ? 1 d none /usr/bin ? ? ? 1 i pkginfo 153 11910 910987246 1 i postinstall 7236 49083 910380718 1 i preremove 2297 53043 910380718 1 i request 13550 13482 910380718 07070100000000000000000000000000000000000000010000000000000000000000000000000000000000000000000000000b00000000TRAILER!!!0707010005b112000081a4000000000000000100000001364c8fee00000099000000ad0000000400000000000000000000000800000004pkginfoPKG=pcxx NAME=Digi, Intl. Async Driver Package ARCH=i386 VERSION=1.4.0 CATEGORY=system,utilities CLASS=none build PSTAMP=ews219981113140046 CLASSES=none 0707010005b111000081a4000000000000000100000001364c8f72000004da000000ad0000000400000000000000000000000700000004pkgmap: 1 773 1 d none /tmp ? ? ? 1 d none /tmp/pcxx 0700 root root 1 f none /tmp/pcxx/ditty 0755 bin bin 26140 11435 910987005 1 f none /tmp/pcxx/ditty.1 0644 root root 7153 19551 910380713 1 f none /tmp/pcxx/dpa 0755 bin bin 140788 6474 910986836 1 f none /tmp/pcxx/dpa_info 0444 bin bin 284 23680 910380714 1 f none /tmp/pcxx/dpa_info1 0444 bin bin 2427 55241 910380714 1 f none /tmp/pcxx/dpa_info2 0444 bin bin 828 3376 910380714 1 f none /tmp/pcxx/dpa_info3 0444 bin bin 546 47487 910380714 1 f none /tmp/pcxx/dpa_info4 0444 bin bin 4051 42469 910380714 1 f none /tmp/pcxx/dpa_info5 0444 bin bin 2843 18593 910380714 1 f none /tmp/pcxx/dpa_info6 0444 bin bin 490 38968 910380714 1 f none /tmp/pcxx/dpa_info7 0444 bin bin 7585 36245 910380714 1 v none /tmp/pcxx/pcxx 0777 root root 112300 14540 910986969 1 v none /tmp/pcxx/pcxxconfig 0777 root root 7876 26444 910380715 1 v none /tmp/pcxx/pcxxdl 0777 root root 6884 52887 910986986 1 v none /tmp/pcxx/pcxxmknod 0777 root root 8236 33972 910380715 1 f none /tmp/pcxx/stdigi.h 0644 root root 8175 11575 910380718 1 d none /usr ? ? ? 1 d none /usr/bin ? ? ? 1 i pkginfo 153 11910 910987246 1 i postinstall 7236 49083 910380718 1 i preremove 2297 53043 910380718 1 i request 13550 13482 910380718 07070100062d1d000041ed000000000000000100000002364c8f7500000000000000ad0000000400000000000000000000000800000004install07070100062d1e000081a400000000000000010000000136434eae00001c44000000ad0000000400000000000000000000001400000004install/postinstall# ex:se ts=8 sw=8: #!/bin/sh #################################################################### # # ident "@(#)postinstall 1.10 98/09/26" # ident "$Header:$" # # Copyright (c) 1988-96 Digi International Inc., All Rights Reserved. # This software contains proprietary and confidential information of Digi # International Inc. By accepting transfer of this copy, Recipient agrees # to retain this software in confidence, to prevent disclosure to others, # and to make no use of this software other than that for which it was # delivered. This is an unpublished copyrighted work of Digi International # Inc. Except as permitted by federal law, 17 USC 117, copying is strictly # prohibited. # # Post-Installation script for Digi, Intl. PC/Xx async driver. # #################################################################### # Main Postinstall Processing # Check if a needed variable is defined. If not # get out before we hurt someone. if [ ! "$MYNAME" ] ; then echo no response file supplied exit 1 fi home_dir=`pwd` cd /tmp/$MYNAME # Test if we are installing overtop of ourselves. If we are, # then remove the drivers and kill the download daemon ############################################################## if ls /kernel/drv/${MYNAME} 1>/dev/null 2>/dev/null ; then echo removing previous instance .... sync rem_drv ${MYNAME}dl 1>/dev/null 2>/dev/null rm -rf /kernel/drv/${MYNAME}dl sync rem_drv ${MYNAME} 1>/dev/null 2>/dev/null rm -rf /kernel/drv/${MYNAME} sync # get forceload stuff out of etc/system grep ${MYNAME} /etc/system > /dev/null [ $? = 0 ] && { sed "/${MYNAME}/d" /etc/system > /etc/system.ed cp /etc/system.ed /etc/system } # This is not good enough if people change TTYNAME and PRNAME [ -d /dev/dty ] && rm -f /dev/dty/i?[a-zA-Z] [ -d /dev/dpr ] && rm -f /dev/dpr/i?[a-zA-Z] # # Remove useless symbolic links # ( cd /dev/term; ls -al | awk ' /dty.i/ { print $9 } ' | xargs rm -f ) rm -f /usr/bin/dpa /usr/bin/ditty fi rm -rf /opt/$MYNAME 2>/dev/null ############################################################## > ${MYNAME}.nodes echo "Building the node file, please stand by ....\n" n=1 while [ $n -le $NBRDS ] do minor=`expr \( $n - 1 \) \* 64` eval mports=\$PORTS$n ./${MYNAME}config $n 1 $minor $mports >> ${MYNAME}.nodes n=`expr $n + 1` done echo "\t\tInstalling ${FULLNAME} driver ... " > ${MYNAME}.conf > ${MYNAME}dl.conf echo "name=\"${MYNAME}dl\" class=\"sysbus\" reg=0xdead,0,0;" \ > ${MYNAME}dl.conf echo "\ # # This file contains the values needed by the driver # at load time. For the most part the information can # be changed without adverse affect, if the config string # needs changing, the values MUST be decimal and the end # of the string must remain as a \"-1\". #" > ${MYNAME}.conf n=1 while [ $n -le $NBRDS ] do l=`expr $n - 1` echo "name=\"${MYNAME}\" class=\"sysbus\"" >> ${MYNAME}.conf echo "bustype=\"isa\"" >> ${MYNAME}.conf eval altn=\$ALTPIN$n eval nports=\$PORTS$n eval fepsize=\$MEM${n}END eval fepmem=\$MEM$n eval ioloc=\$IOP$n echo "ioaddr=0x${ioloc} " >> ${MYNAME}.conf echo "nports=${nports} altpin=${altn}" >> ${MYNAME}.conf echo "ncards=${NBRDS} boardnum=$n" >> ${MYNAME}.conf echo "reg=0x${ioloc},0x0,0x0,0x0,0x${fepmem},0x${fepsize}" >> ${MYNAME}.conf configstr="-1" echo "config=${configstr};\n" >> ${MYNAME}.conf n=`expr $n + 1` done # # echo "test exit" ; exit 1 # # # set up an rc file to start the download program # echo "\ # # Startup digiboard download program # echo \"Digi configuration initiated...\" rm -f /dev/${MYNAME}dl modinfo | grep ${MYNAME}dl > /dev/null [ \$? = 0 ] && { [ ! -d /dev/${TTYNAME} ] && mkdir /dev/${TTYNAME} [ ! -d /dev/${PRNAME} ] && mkdir /dev/${PRNAME} modinfo | grep $MYNAME > /tmp/.xxy major=\`sed '/${MYNAME}dl/d' /tmp/.xxy\` major=\`echo \$major | awk '{print \$4}'\` autopush -r -M \$major -m 0 2>/dev/null [ ! -z \"\$major\" ] && { /etc/${MYNAME}mknod /etc/.${MYNAME}.nodes \$major } if [ \"$LN_TERM\" = \"yes\" ] ; then SAVEDIR=\`pwd\` cd /dev/$TTYNAME if ls -al /dev/term | grep ${TTYNAME}i 1>/dev/null 2>/dev/null; then : \# Do nothing if links are already there else for file in i?[a-zA-Z] ; do ln -s /dev/${TTYNAME}\${file} /dev/term/\$file 2>/dev/null done fi cd \$SAVEDIR fi echo \"Digi ports created\" major=\`modinfo | grep ${MYNAME}dl | awk '{print \$4}'\` [ -z \"\$major\" ] && exit 1 mknod /dev/${MYNAME}dl c \$major 0 echo \"${MYNAME} -1 0 ldterm ttcompat\" > /tmp/.${MYNAME}pushlist autopush -f /tmp/.${MYNAME}pushlist }" > Rc # # echo "test exit" ; exit 1 # [ ! -d /etc/rc2.d ] && mkdir /etc/rc2.d ## # Move the Rc script to it's directory. ## mv -f Rc /etc/rc2.d/S89${MYNAME} # # move download program into place # [ -f /etc/${MYNAME}dl ] && mv /etc/${MYNAME}dl /etc/${MYNAME}dl.old ## # Move the modules and their conf files into place. ## mv ${MYNAME} /kernel/drv/${MYNAME} mv ${MYNAME}dl /kernel/drv/${MYNAME}dl mv ${MYNAME}.conf /kernel/drv/${MYNAME}.conf mv ${MYNAME}dl.conf /kernel/drv/${MYNAME}dl.conf ## # Edit the system file so we will be loaded at boot time. ## sed "/${MYNAME}/d" /etc/system > /etc/system.ed #sed "/forceload/a\\ #forceload: drv/${MYNAME}\\ #forceload: drv/${MYNAME}dl" /etc/system.ed > /etc/system ed /etc/system.ed </dev/null /forceload/ /^$/ i forceload: drv/$MYNAME forceload: drv/${MYNAME}dl . w /etc/system q ! #add_drv -m '* 0666 root root' $MYNAME add_drv $MYNAME [ $? != 0 ] && { sed "/${MYNAME}/d" /etc/system > /etc/system.ed cp /etc/system.ed /etc/system rm /etc/rc2.d/S89${MYNAME} rm /kernel/drv/${MYNAME} rm /kernel/drv/${MYNAME}dl rm /kernel/drv/${MYNAME}.conf rm /kernel/drv/${MYNAME}dl.conf exit 1 } add_drv ${MYNAME}dl chmod +x /etc/rc2.d/S89$MYNAME [ ! -d /opt ] && mkdir /opt [ ! -d /opt/$MYNAME ] && mkdir /opt/$MYNAME mv -f stdigi.h /opt/$MYNAME mv -f ditty /opt/$MYNAME mv -f ditty.1 /opt/$MYNAME mv -f dpa /opt/$MYNAME mv -f dpa_* /opt/$MYNAME # # save the node list. # mv -f ${MYNAME}.nodes /etc/.${MYNAME}.nodes mv -f ${MYNAME}mknod /etc/${MYNAME}mknod rm -f ${MYNAME}config ln -s /opt/${MYNAME}/ditty.1 /usr/man/man1/ditty.1 2>/dev/null ln -s /opt/${MYNAME}/stdigi.h /usr/include/sys/stdigi.h 2>/dev/null ln -s /opt/${MYNAME}/ditty /usr/bin/ditty 2>/dev/null ln -s /opt/${MYNAME}/dpa /usr/bin/dpa 2>/dev/null chmod 6755 /etc/${MYNAME}mknod # Now set up DPA's help files mkdir -p /etc/digi/text/info 2> /dev/null rm -rf /etc/digi/text/info/dpa_info* 2>/dev/null ln -s /opt/${MYNAME}/dpa_info /etc/digi/text/info/dpa_info ln -s /opt/${MYNAME}/dpa_info1 /etc/digi/text/info/dpa_info1 ln -s /opt/${MYNAME}/dpa_info2 /etc/digi/text/info/dpa_info2 ln -s /opt/${MYNAME}/dpa_info3 /etc/digi/text/info/dpa_info3 ln -s /opt/${MYNAME}/dpa_info4 /etc/digi/text/info/dpa_info4 ln -s /opt/${MYNAME}/dpa_info5 /etc/digi/text/info/dpa_info5 ln -s /opt/${MYNAME}/dpa_info6 /etc/digi/text/info/dpa_info6 ln -s /opt/${MYNAME}/dpa_info7 /etc/digi/text/info/dpa_info7 installf ${PKGINST} /tmp/${MYNAME} >/dev/null 2>&1 installf -f ${PKGINST} >/dev/null 2>&1 removef ${PKGINST} /tmp/${MYNAME}/* >/dev/null 2>&1 removef -f ${PKGINST} >/dev/null 2>&1 cd $home_dir /etc/rc2.d/S89${MYNAME} # exit 10 # Tell user to reboot exit # }] 07070100062d1f000081a400000000000000010000000136434eae000008f9000000ad0000000400000000000000000000001200000004install/preremove## # ex:se ts=8 sw=8 sm: # # Copyright (c) 1988-92 Digi International Inc., All Rights Reserved. # This software contains proprietary and confidential information of Digi # International Inc. By accepting transfer of this copy, Recipient agrees # to retain this software in confidence, to prevent disclosure to others, # and to make no use of this software other than that for which it was # delivered. This is an unpublished copyrighted work of Digi International # Inc. Except as permitted by federal law, 17 USC 117, copying is strictly # prohibited. # # Operating System: Solaris 2.1 # # ident "@(#)preremove 1.7 96/11/14" # ident "$Header:$" ## #FETCH=FIX THIS NAME=pcxx DLNAME=pcxxdl FULLNAME="Digi, Intl. PC/X* Driver Package" TMP=/tmp/$NAME.err ERROR=" An error was encountered removing the $FULLNAME. The file $TMP contains errors reported by the system." echo "Removing $FULLNAME..." /etc/fuser -k /dev/${DLNAME} 2>/dev/null reboot_code=0 rem_drv ${DLNAME} 2>$TMP [ $? != 0 ] && reboot_code=10 # need to reboot rem_drv ${NAME} 2>$TMP [ $? != 0 ] && reboot_code=10 # need to reboot grep ${NAME} /etc/system > /dev/null [ $? = 0 ] && { sed "/${NAME}/d" /etc/system > /etc/system.ed cp /etc/system.ed /etc/system } [ -d /opt -a -d /opt/${NAME} ] && rm -rf /opt/$NAME [ -f /kernel/drv/${NAME} ] && rm -f /kernel/drv/${NAME} [ -f /kernel/drv/${DLNAME} ] && rm -f /kernel/drv/${DLNAME} [ -f /kernel/drv/${NAME}.conf ] && rm -f /kernel/drv/${NAME}.conf [ -f /kernel/drv/${DLNAME}.conf ] && rm -f /kernel/drv/${DLNAME}.conf [ -f /etc/${NAME}mknod ] && rm -f /etc/${NAME}mknod [ -f /etc/${DLNAME} ] && rm -f /etc/${DLNAME} [ -c /dev/${DLNAME} ] && rm -f /dev/${DLNAME} [ -f /etc/.${NAME}.nodes ] && rm -f /etc/.${NAME}.nodes [ -f /etc/rc2.d/S89${NAME} ] && rm -f /etc/rc2.d/S89${NAME} [ -d /dev/dty ] && rm -f /dev/dty/i?[a-zA-Z] [ -d /dev/dpr ] && rm -f /dev/dpr/i?[a-zA-Z] # # Remove useless symbolic links # ( cd /dev/term; ls -al | awk ' /dty.i/ { print $9 } ' | xargs rm -f ) symlist="/usr/bin/dpa /usr/bin/ditty /usr/man/man1/ditty.1 /usr/include/sys/stdigi.h /etc/digi/text/info/dpa_info* " for symlnk in $symlist ; do [ -h "$symlnk" -a \! -f $symlnk ] 2>/dev/null && rm -f $symlnk done # # All done, remove the error file and leave # rm -f $TMP exit $reboot_code 07070100062d20000081a400000000000000010000000136434eae000034ee000000ad0000000400000000000000000000001000000004install/request# ex:se ts=8 sw=8: #!/bin/sh #################################################################### # # ident "@(#)request 1.1 96/11/13" # ident "$Header:$" # # Copyright (c) 1988-96 Digi International Inc., All Rights Reserved. # This software contains proprietary and confidential information of Digi # International Inc. By accepting transfer of this copy, Recipient agrees # to retain this software in confidence, to prevent disclosure to others, # and to make no use of this software other than that for which it was # delivered. This is an unpublished copyrighted work of Digi International # Inc. Except as permitted by federal law, 17 USC 117, copying is strictly # prohibited. # # pkgask request script for Digi, Intl. PC/Xx async driver. # #################################################################### ## [{ # Main Request Processing ## # the following lines are only for testing ## #-if [ -z "$1" ] #-then #- echo "Usage: $0 " #- exit 1 #-fi #-if [ -n "$2" ] #-then #- PLATFORM=$2 #-fi #-REL="$1" ## # Test for operating system ## REQUEST_FILE=$1 osrel=`uname -r` case "$osrel" in [52].*) echo ;; *) echo "\tThis installation is for Solaris 2.x only" exit 1 ;; esac getyn='( while read yn do case "$yn" in [yY]) exit 0 ;; [nN]) exit 1 ;; *) echo "Please answer y or n" >&2 ;; esac done)' ## # this is called as: getparm [file] [key] [field] # return value is the value of field y in file x. ## getparm() { getfield=$3 set `grep "$2" $1 || echo 0` eval echo \$$getfield } ## # Usage: setparm [file] [key] [field] [value] ## setparm() { ed - <<-! $1 g/$2/s/[^ ]\{1,\}/$4/$3 w q ! } hex2dec() { t1=$1 case "$1" in 0x*) tmp1=`expr "$1" : "0x\(.*\)"` tmp=`echo "$tmp1" | tr "[a-z]" "[A-Z]"` t1=`echo 16 i $tmp p | dc` ;; esac echo $t1 } ## # Useful stuff. ## MYNAME=pcxx DLNAME=pcx1 FULLNAME="Digi, Intl. PC/X*" MAX_NBRDS=4 configoption=0 ttyname=dty/ prname=dpr/ termtype=${TERM:-ansi} b=`tput -T$termtype smso` d=`tput -T$termtype rmso` cr="Copyright (C) 1990-91 Digi, Intl. All Rights Reserved" TMP=/tmp/$MYNAME.err CONFDIR=/etc/conf VMSYS=/usr/vmsys PATH=$PATH:. ## # Configuration loop ## while : do ## # Initialize variables ## FEPPORT="" FEPMEM="" FEPMEMEND="" NUMPORTS="" CONFIG="" TOTAL=0 ## # Useful stuff. ## MAX_NBRDS=4 ## # Query for installation options ## tput -T$termtype clear echo "$b $cr $d" echo " The $FULLNAME driver may be installed using one of the four suggested configurations listed below, or you may choose to create your own custom configuration. 1) I/O Port=0x320, Memory Address=0x000D0000, 64K board 2) I/O Port=0x300, Memory Address=0x00F00000, 64K board 3) I/O Port=0x220, Memory Address=0x000D0000, 64K board 4) I/O Port=0x120, Memory Address=0x00F00000, 64K board 5) Custom or multiple board installation. 6) Exit installation procedure. Please enter selection (1-6)? \c" while : do read configoption case "$configoption" in 1|2|3|4|5) break ;; 6) exit 1 ;; *) echo \ "\tPlease enter a number between 1 and 6: \c" ;; esac done if [ $configoption -lt 5 ] then ## # Pre-configured installation ## tput -T$termtype clear echo "$b $cr $d" case "$configoption" in 1) NBRDS=1 FEPPORT="320" iop1="320" FEPMEM="0D0000" mem1="0D0000" mem1end="010000" LN_TERM=yes ;; 2) NBRDS=1 FEPPORT="300" iop1="300" FEPMEM="F00000" mem1="F00000" mem1end="010000" LN_TERM=yes ;; 3) NBRDS=1 FEPPORT="220" iop1="220" FEPMEM="0D0000" mem1="0D0000" mem1end="010000" LN_TERM=yes ;; 4) NBRDS=1 FEPPORT="120" iop1="120" FEPMEM="F00000" mem1="F00000" mem1end="010000" LN_TERM=yes ;; esac # ## # # Check I/O Port Address Conflict # ## # DNAME=`/etc/conf/bin/idcheck -r -a -l $FEPPORT -u $FEPPORT` # if [ $? != 0 -a "$DNAME" != "$MYNAME" ] # then # echo " # The I/O port address 0x${FEPPORT} conflicts with the installed '$DNAME' driver." # echo " # Hit to go back to the previous step ==> \c" # read aa # continue # fi # # ## # # Check Memory Address Conflict. # ## # DNAME=`/etc/conf/bin/idcheck -r -c -l $mem1 -u $mem1end` # if [ $? != 0 -a "$DNAME" != "$MYNAME" ] # then # echo " # The physical memory address range 0x00${mem1} - 0x00${mem1end}" # echo "\tconflicts with the installed '${DNAME}' driver." # echo "\tHit to go back to the previous step ==> \c" # read aa # continue # fi N=1 echo " Please indicate number of ports on this board #${N} (2, 4, 8, or 16): \c" while : do read sel case "$sel" in 2) NUMPORTS="$NUMPORTS $sel" ports1=$sel TOTAL=`expr $TOTAL + $sel` LOWER="b" UPPER="B" ;; 4) NUMPORTS="$NUMPORTS $sel" ports1=$sel TOTAL=`expr $TOTAL + $sel` LOWER="d" UPPER="D" ;; 8) NUMPORTS="$NUMPORTS $sel" ports1=$sel TOTAL=`expr $TOTAL + $sel` LOWER="h" UPPER="H" ;; 16) NUMPORTS="$NUMPORTS $sel" ports1=$sel TOTAL=`expr $TOTAL + $sel` LOWER="p" UPPER="P" ;; *) echo "\tPlease enter 2, 4, 8, or 16: \c" continue ;; esac break done CONFIG="1 $FEPPORT $FEPMEM $NUMPORTS $LOWER $UPPER" echo " Altpin is provided to enable DCD input signal to be exchanged with the DSR input. This is useful on products with RJ-45 connectors as these products have DCD on pin 10. Choosing altpin will allow the use of 8-pin connectors while still having the benefit of full modem control. The use of "altpin" on products with DB-25 connectors is not normally recommended. " echo " Do you want to set altpin for this board? (y or n) \c" if eval "$getyn" then altpin1=1 echo "\t\tAltpin is set to on.\n" else altpin1=0 echo "\t\tAltpin is set to off.\n" fi else ## # Custom installation ## echo " Each Digi, Intl. PC/X* board requires an I/O port address and a 8K to 512K block of memory. Please select these to avoid conflicts with other boards you may have installed in your system. How many $FULLNAME boards do you wish to install (1-${MAX_NBRDS})? \c" while : do read NBRDS case $NBRDS in 1|2|3|4) NBRDS=$NBRDS break ;; *) echo " Please enter a number between 1 and ${MAX_NBRDS}: \c" ;; esac done # Prompt for whether they want /dev/term file names echo " Many Solaris applications expect serial port devices to have links in the /dev/term directory. The dial-in devices (which wait for Carrier Detect on open) will end in a upper-case letter (i.e. i1A), and the dial-out devices (which do not wait for CD on open) will end in a lower-case letter. (i.e. i1a). Do you want links to the /dev/term directory created for you (y or n)? \c" if eval "$getyn" then LN_TERM=yes else LN_TERM=no fi N=1 while [ $N -le $NBRDS ] do tput -T$termtype clear echo "$b $cr $d" CONFIG="$CONFIG $N" echo " Ready to configure board #${N}. =========================== The I/O port address choices, in hexadecimal, are: 100 200 300 110 220 320 120 Please enter selection (100-320): \c" while : do read sel case "$sel" in 100|110|120|200|220|300|320) # DNAME=`/etc/conf/bin/idcheck -r -a -l $sel -u $sel` # if [ $? != 0 \ # -a "$DNAME" != "$MYNAME" ] # then # echo " #The I/O port address 0x${sel} conflicts with the installed '$DNAME' driver." # echo " # Please select another one (100-320): \c" # continue # fi ;; *) echo " Please enter a number between 100 and 320: \c" continue ;; esac case " $FEPPORT " in *" $sel "*) echo " Conflict with previously selected I/O address. Please enter another selection (100-320)? \c" continue ;; esac FEPPORT="$FEPPORT $sel" eval iop${N}=$sel break done CONFIG="$CONFIG $sel" tput -T${termtype} clear echo " Does this board have 8K of dual-ported memory or 64K? (8 or 64): \c" while : do read memsize case $memsize in 8) BRDMEM=8 break ;; 64) BRDMEM=64 break ;; *) echo "Please enter 8 or 64: \c" continue ;; esac done echo " The memory address choices, in hexadecimal, are: 08) 0x00080000 09) 0x00090000 0C) 0x000C0000 0D) 0x000D0000 0C2) 0x000C2000 * 0D2) 0x000D2000 * 0C4) 0x000C4000 * 0D4) 0x000D4000 * 0C6) 0x000C6000 * 0D6) 0x000D6000 * 0C8) 0x000C8000 * 0D8) 0x000D8000 * 0CA) 0x000CA000 * 0DA) 0x000DA000 * 0CC) 0x000CC000 * 0DC) 0x000DC000 * 0E) 0x000E0000 *) Addresses marked are for use only with the PC/X* boards with the 8K window. D0) 0x00D00000 D8) 0x00D80000 E0) 0x00E00000 E8) 0x00E80000 F0) 0x00F00000 F8) 0x00F80000 Please enter selection code (08-F8): \c" while : do read sel sel=`echo $sel | tr "[a-z]" "[A-Z]"` case "$sel" in 08|09|0[C-E]|[D-F][08]) memstart="${sel}0000" eval mem${N}="${sel}0000" if [ $BRDMEM = "8" ] then eval mem${N}end="2000" else eval mem${N}end="10000" fi # DNAME=`/etc/conf/bin/idcheck -r -c -l $memstart -u $memend` # # if [ $? != 0 \ # -a "$DNAME" != "$MYNAME" ] # then # echo " # The physical memory address range 0x00${memstart} - 0x00${memend} # conflicts with the installed '${DNAME}' driver. # Please enter another selection code (08-F8): \c" # continue # fi FEPMEM="$FEPMEM ${sel}0" ;; 0[CD][2468AC]) memstart="${sel}000" eval mem${N}="${sel}000" eval mem${N}end="2000" # DNAME=`/etc/conf/bin/idcheck -r -c -l $memstart -u $memend` # # if [ $? != 0 \ # -a "$DNAME" != "$MYNAME" ] # then # echo " # The physical memory address range 0x00${memstart} - 0x00${memend} # conflicts with the installed '${DNAME}' driver. # Please enter another selection code (08-F8): \c" # continue # fi FEPMEM="$FEPMEM $sel" ;; *) echo " Please enter one of the choices indicated: \c" continue ;; esac break done CONFIG="$CONFIG $memstart" echo " Please indicate number of ports on board #${N} (2, 4, 8, or 16): \c" while : do read sel case "$sel" in 2) NUMPORTS="$NUMPORTS $sel" eval ports${N}=$sel TOTAL=`expr $TOTAL + $sel` LOWER="b" UPPER="B" ;; 4) NUMPORTS="$NUMPORTS $sel" eval ports${N}=$sel TOTAL=`expr $TOTAL + $sel` LOWER="d" UPPER="D" ;; 8) NUMPORTS="$NUMPORTS $sel" eval ports${N}=$sel TOTAL=`expr $TOTAL + $sel` LOWER="h" UPPER="H" ;; 16) NUMPORTS="$NUMPORTS $sel" eval ports${N}=$sel TOTAL=`expr $TOTAL + $sel` LOWER="p" UPPER="P" ;; *) echo "\tPlease enter 2, 4, 8, or 16: \c" continue ;; esac break done CONFIG="$CONFIG $sel $LOWER $UPPER" tput -T${termtype} clear if [ $N = 1 ] then echo " Altpin is provided to enable DCD input signal to be exchanged with the DSR input. This is useful on products with RJ-45 connectors as these products have DCD on pin 10. Choosing altpin will allow the use of 8-pin connectors while still having the benefit of full modem control. The use of "altpin" on products with DB-25 connectors is not normally recommended. " fi echo " Do you want to set altpin for this board? (y or n) \c" if eval "$getyn" then eval altpin${N}="1" echo "\t\tAltpin is set to on.\n" else eval altpin${N}="0" echo "\t\tAltpin is set to off.\n" fi sleep 1 N=`expr $N + 1` done fi tput -T$termtype clear echo "$b $cr $d" echo " You have selected the following configuration: Board I/O Address Memory Address Devices -----------------------------------------------------" set $CONFIG 0 0 0 0 0 N=1 while [ $N -le $NBRDS ] do echo \ " $1 0x${2} 0x00${3} ${ttyname}i${N}a - ${ttyname}i${N}$5 Modem devices: ${ttyname}i${N}A - ${ttyname}i${N}$6" shift;shift;shift;shift;shift;shift N=`expr $N + 1` done if [ "$LN_TERM" = "yes" ] ; then M=`expr $N - 1` # if M is more than 1, there are multiple boards # Note that N was incremented above if [ "$M" -gt 1 ] ; then echo \ " linked to /dev/term/i[1-${M}][xX]" else echo \ " linked to /dev/term/i${M}[xX]" fi fi echo " Is this configuration acceptable (y or n)? \c" if eval "$getyn" then break fi done CACHE=00 # this is new stuff that I added to export the variables to # the postinstall script set $REQUEST_FILE cat >>$1 <> $1 eval tmp=\$ports$n echo PORTS${n}=$tmp >> $1 eval tmp=\$mem${n}end echo MEM${n}END=$tmp >> $1 eval tmp=\$mem$n echo MEM${n}=$tmp >> $1 eval tmp=\$iop$n echo IOP${n}=$tmp >> $1 n=`expr $n + 1` done #end of request script 0707010005d020000041ed000000000000000100000003364c8f7200000000000000ad0000000400000000000000000000000500000004root0707010005ef12000041ed000000000000000100000003364c8f7200000000000000ad0000000400000000000000000000000900000004root/tmp07070100060e1b000041ed000000000000000100000002364c8f7400000000000000ad0000000400000000000000000000000e00000004root/tmp/pcxx07070100060e1c000081ed000000020000000200000001364c8efd0000661c000000ad0000000400000000000000000000001400000004root/tmp/pcxx/dittyELF4a4 (44:::& D;D/usr/lib/ld.so.1ayBIf%abq,wcuek34&\^W;8M]sE#t:+ohd!l[xLpTP$`XJKrO5mDAS Q9jgvi/)(.6'"=F@HUV-C1?ZR*0<7NGn2_>YԀX\   $ P D$ + 3CH N Tp]fkprܔw!| Lܓl\' $LdT  &*t1@0@FK4S X|`Di<qw,}  !̓< 8|$+T1 3\:̔AHNT[ u {8 ,0@ P  X l$* `< digi_gedelay_namedigi_tcxonc_name_start_mcountdigi_gpoll_nameatoicatchflushloopback_environ_endfbaud_fork_iob_ex_register_GLOBAL_OFFSET_TABLE_sleepparmtcxoncsignalatexitexitalarmmodem0modem1_xstatsprintfrport_name_initdigifputcduppresetstprint_fxstattgetstrttymynamedigi_geta_namefbaudterm___Argvwaitstrncpy_DYNAMICstrncmp__iobioctlparallelgetcode_ex_deregisterenvironperrorsendbreakerrnodigi_spoll_name__fpstarttgetent__fnonstd_useddigi_sedelay_nameclose_lxstat__longdouble_usedopenedelaydigigetstrcmpsystempwidthflag0flag1_edata_PROCEDURE_LINKAGE_TABLE_dittydigiset__fsr_init_valueexecvpstrcpysbaud_etext_lib_versionfflushprintnparm__fsrmainstrlen__environ_lockntty_finiterm_typefprintf_xmknodlibcurses.so.1SUNWprivate_1.1libc.so.1SUNW_0.7libcurses.so.1libc.so.1 qN $4(= >*NJ0T15Y>xKw:^rGU?Pm_( ,hF!i I$/(6,20[4X8;5%%h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h%h% h%h%h%h%hp% h`%$hP%(h@%,h0%0h %4h%8hjjRDth$ETRU 4RP&  PjÐURQ|$fd$ʁ3@D$с` r*f T$сf T$сf T$l$  f T$l$5u <YZ]Uu uj$ Uu uj Uu uj Uuu uj  UEdEE$E EEPhSu ÐUEd+EEE EEPhSu ÐUWVSE uuNFX"t9\@C=euIЀCyuӋo+};s+W+_[^_ÍPЃw$TËڊ҃0|9Ѝ@Ou랐@"u^t;G?UWVSu N#|>} ~|PhS SPGN#}[^_ÐUWVS#++P<`Pl#tF|}tVa|WM=v<vjVh- jWh j 5h "i(E5(P=u/uVh#tVh#5hSM 55thS35thS h8S+5@`PVS GǙ#uhHS|hPSnWV=v<vjWS jVh j 5h +u<tWhTV$ =t]G|+<tWhdV =t>G|ڃ=jhTV =hd]hXV5LhpEh|>h5h-5$555t hhl="thWG+DžtDžDž$ =PhSV =$%4E+%E+E %E+E@%E+%E+%E+PSRuuVhW^ "thWGW=uh$=u h4+hj[^_Ð==Dž$DžtDžDž$ WhSV| =DžtDžDž WhSV> = #tPDžtDžDž$ $PhSV =: t5PV=4f t #tPDžtDžDž$ $PhSVP = #|K=DDždDžDž PhSV #_KDždDžDž PhSV #} ==tw 6uj8 =t#u)hh($hjj;tj;u=uF=u=f=u3f=u)f=u=u=u =SV=8= fff# ɀf fff#tfff#tfff#tf"tjhP} "tjhPX W?#tj W P9 SV=]p=u9pjhetV =u=hhз&#u!pjhdtVq =tˡ#tk=tbWhTVC =Aff% f fWhTV =u h  +#*#PV=tPhTV =u hff%t 8@Ph=Wp ft H LtTXPQEE 5$h,W PhtV =f%E+f %E+Ef@% E+fƀ%E+f%E+PSQuRhTWkft`dt5l5ptx|t  Mt   t PQuRVShxW WR#ePV=JTDždDžDž PhSVU =u+ɋ0A~.ff%8fH+p0A~ꍅPWV =}ff%E荅lPh TV =Shȸ=WPPhԸWPPhWi S$SyhWCfPfPfPhWft  t $t "u v t E0 E0PSRQhWt  Ph@Wr 5hPW^ h`WP@tPhhW* ft  M@ttt   tPQRSuhtWNUÐU WVSM;# } MMEhDSF#;u4%f4 f4f4p |$7hh j_ AE)4hhthhF p p        { l \ @L @?  &              t d W @H @8 (            p  V  <  "  qa |$7h$h jB AMhS#jhS] #tjhSI #vjhS1 #^jhS #FjhS #.jhS #jhS #=d|#7hHh j?@hPS#u ;u5h\S~#u ;u2hhSc#u ;uhSH#u%;u} 4h[h{hS#u ;uhS#_hS#YhS#]hS#_hS#WhS#QhSr#KhS\#BhSF#;hS0#5h S#/hS#&h$S#)h0S#*h<S##hHS#hTS#h`S# hlSj#hxST#hS>#hS(#hS#hS#hS#hS#hS#hS#hS#hSx#hSb#h SL#hS6#h(S #h4S #h<S#ihLS#chXS#dhdS#hpS#h|S#;hSp#hSZ#hSD#hS.#hS#hS#hS#hS#whS#ahS#KhS#^hS~#HhSh#LhSR#6hS<#:hS&#>hS#BhS#,hS#0h S#h(S#h0S#h8S# h@Sv#hHS`#hPSJ#hXS4#h`S#hhS#hpS#hxS#hS#hS#;uE@<0|<9q;uM@; #ujhj2+;5<?/tWhp}W jhWj#}+= Wuh|h VKj$$=t=~Whhd jF;59+[^_ÐS[òу:tQ[S[Êу:tQ[ؗؗؗؗؗؗؗؗؗؗؗ—\%03oNo printer on/off strings for term %s in terminfo. %s: invalid terminal type: %s %s: valid terminal types are: %s TCFLSHTCSBRKTIOCMBICTIOCMBISTIOCMBICTIOCMBIS/bin/sttyioctl TIOCSMLB (tIOC|101)ioctl TIOCCMLB (tIOC|100)TCGETATCSETATCGETAparallel %sput port pulse width %.1f us %snoack %shupcl BUSY%c IPO%c IP1%c IP2%c OP%c %sopost %solcuc %sonlcr %socrnl %sonocr %sonlret TCGETATCGETSonstr offstr term maxcps %d maxchar %d bufsize %d %sforcedcd %saltpin %sfastbaud (%d) %sprinter edelay (%d) eia%s %srtspace %sdtrpace %sctspace %sdsrpace %sdcdpace DTR%c RTS%c CTS%c CD%c DSR%c RI%c @$@%s: too many tty devices given! %s: too many tty devices given! %s: too many stty parameters given! /dev/%s%s: another process waiting on open ####### %s D“ғ"2BRbr”Ҕ"2BRbrGV  $o\o tX o $04( ,8<!%15 ) -9=adm31d#ansidg200F?3F?2dg210F?3F?2hz1500d#mc5d#microtermmultitermd#pcterm`atvi`avp-a234vp-6034vt52WXvt100vt220wang2x36wyse30wyse50wyse60d#wyse752Kn,X` %K%,@8p,X` %K%K@8,p` %K%,@8p,pp` %K%,@8,pp%K%2Kn,X` %K%,@8,Xp` %KF,@8,Xp` %K,,X` %KxdittyDIGI_TCXONCDIGI_GETADIGI_SEDELAYDIGI_GEDELAYDIGI_SPOLLDIGI_GPOLLȖd2 popfstty/bin/sttyinout------------422232-----/bin/stty/bin/stty -amaxcpsmaxcharbufsizeonstrunknownoffstrunknowntermloopback-loopback-dtrdtr-rtsrtsrtspace-rtspacectspace-ctspacedtrpace-dtrpacedsrpace-dsrpacedcdpace-dcdpaceflushinflushoutflushbreakstopoutstartoutstopinstartinfastbaud-fastbaudprinter-printereia422eia232forcedcd-forcedcdaltpin-altpin-p-paralleloutputinputnoack-noackreset-OP-opOP-op-OPop+OP+opOP+op+0.8.81.01.1.21.62.023.034.0410.01020.02030.03040.04050.0-aedelay-n/dev/dty/dpr/term/ttycuprԀX\   $ P D %067@ BNOPQRS[`foT ~ Ж        p(16p=ܔB!G Tjpu|Lܓl\' $LdT  t 0@4$ )|1D:<BH,NW _ n!v}̓<8|T1 \ ̔%, F L8 Tel,s0@y P  X l$* `<dittycrti.s_ex_shared0_ex_text0_ex_range0fsr.strap_tablevalues-Xa.cditty.cDdata.dataBbss.bssDrodata.rodatapbaudstatlstatfstatmknodcrtn.s_ex_shared1_ex_text1_ex_range1digi_gedelay_namedigi_tcxonc_name_start_mcountdigi_gpoll_name_START_atoicatchflushloopback_environ_endfbaud_fork_iob_ex_register_GLOBAL_OFFSET_TABLE_sleepparmtcxoncsignalatexitexitalarmmodem0modem1_xstatsprintfrport_name_initdigifputcduppresetstprint_fxstattgetstrttymynamedigi_geta_namefbaudterm___Argv_END_waitstrncpy_DYNAMICstrncmp__iobioctlparallelgetcode_ex_deregisterenvironperrorsendbreakerrnodigi_spoll_name__fpstarttgetent__fnonstd_useddigi_sedelay_nameclose_lxstat__longdouble_usedopenedelaydigigetstrcmpsystempwidthflag0flag1_edata_PROCEDURE_LINKAGE_TABLE_dittydigiset__fsr_init_valueexecvpstrcpysbaud_etext_lib_versionfflushprintnparm__fsrmainstrlen__environ_lockntty_finiterm_typefprintf_xmknodBE built: Oct 4 1996 15:09:56 GMT@(#)ditty.c 1.35 98/08/04$Header:$@(#)xxy_defs.h 1.32 98/09/26$Header:$@(#)types.h 1.63 98/04/28 SMI@(#)isa_defs.h 1.15 97/11/22 SMI@(#)feature_tests.h 1.17 97/12/04 SMI@(#)machtypes.h 1.7 96/05/23 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.62 98/02/04 SMI@(#)time.h 1.36 98/03/27 SMI@(#)time_impl.h 1.3 98/02/13 SMI@(#)param.h 1.63 98/06/03 SMI@(#)unistd.h 1.36 98/07/16 SMI@(#)ioctl.h 1.9 92/07/14 SMI@(#)eucioctl.h 1.10 93/11/01 SMI@(#)systm.h 1.93 98/06/03 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.19 98/02/27 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.10 98/02/18 SMI@(#)proc.h 1.117 98/03/19 SMI@(#)thread.h 1.89 98/06/07 SMI@(#)klwp.h 1.34 98/01/06 SMI@(#)signal.h 1.53 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.8 98/02/05 SMI@(#)faultcode.h 1.15 92/07/14 SMI@(#)pcb.h 1.13 98/06/08 SMI@(#)reg.h 1.15 97/11/05 SMI@(#)msacct.h 1.7 93/07/13 SMI@(#)ucontext.h 1.6 96/04/24 SMI@(#)regset.h 1.1 89/10/03 SMI@(#)lwp.h 1.30 98/01/06 SMI@(#)synch.h 1.35 98/06/05 SMI@(#)cred.h 1.21 97/01/09 SMI@(#)user.h 1.56 98/06/30 SMI@(#)timer.h 1.16 98/01/06 SMI@(#)watchpoint.h 1.6 98/01/06 SMI@(#)seg_enum.h 1.3 95/12/22 SMI@(#)copyops.h 1.3 97/07/07 SMI@(#)segment.h 1.13 98/01/06 SMI@(#)model.h 1.20 97/09/22 SMI@(#)dditypes.h 1.26 98/03/04 SMI@(#)sysmacros.h 1.35 98/06/03 SMI@(#)termio.h 1.11 96/02/07 SMI@(#)termios.h 1.38 98/02/20 SMI@(#)ttydev.h 1.7 92/07/14 SMI@(#)termiox.h 1.9 92/07/14 SMI@(#)stermio.h 1.8 92/07/14 SMI@(#)stropts.h 1.44 98/04/28 SMI@(#)conf.h 1.57 98/01/06 SMI@(#)stream.h 1.79 98/06/11 SMI@(#)vnode.h 1.80 98/08/03 SMI@(#)uio.h 1.29 97/06/29 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)poll.h 1.26 98/06/12 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)strtty.h 1.11 98/01/06 SMI@(#)fcntl.h 1.44 98/06/04 SMI@(#)buf.h 1.43 98/07/14 SMI@(#)types32.h 1.4 98/02/13 SMI@(#)kstat.h 1.14 98/01/06 SMI@(#)errno.h 1.19 98/01/14 SMI@(#)stdigi.h 1.22 98/07/08$Header:$@(#)pcxx.h 1.4 97/08/13@(#)stat.h 1.28 98/03/24 SMI@(#)modctl.h 1.54 98/08/10 SMI@(#)ioccom.h 1.14 97/10/22 SMI@(#)nexusdefs.h 1.13 94/08/09 SMI@(#)devops.h 1.37 98/01/06 SMI@(#)as.h 1.68 98/06/04 SMI@(#)seg.h 1.54 98/05/25 SMI@(#)hat.h 1.81 98/03/13 SMI@(#)page.h 1.112 98/06/29 SMI@(#)ddidmareq.h 1.25 98/01/24 SMI@(#)ddimapreq.h 1.14 96/06/25 SMI@(#)mman.h 1.36 98/06/04 SMI@(#)ddipropdefs.h 1.12 98/01/06 SMI@(#)ddidevmap.h 1.8 98/03/13 SMI@(#)aio_req.h 1.2 94/11/11 SMI@(#)stdio.h 1.69 98/07/13 SMI@(#)va_list.h 1.11 97/11/22 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.7 98/04/17 SMIacomp: WorkShop Compilers 4.2 30 Oct 1996 C 4.2hc2.8h -O0 -386 -fstrict -on SHAREABLE ditty.cas: WorkShop Compilers 4.2 30 Oct 1996ld: Software Generation Utilities - Solaris/ELF (3.0) <E4* b.interp.hash.dynsym.dynstr.SUNW_version.rel.ex_shared.rel.bss.rel.plt.plt.text.init.fini.rodata.got.dynamic.exception_ranges.ex_shared.data.bss.symtab.strtab.comment.stab.index.stab.shstrtab.stab.indexstr.stabstrditty.cXa ; O ; V=3.1 ; R=WorkShop Compilers 4.2 30 Oct 1996 C 4.2/net/cts8/export/home/ews2/pcxx.140; /opt/SUNWspro/bin/../SC4.2/bin/cc -DSOL -DX86 -DPCXX -DISA -DDITTY -O -ltermcap -c ditty.c -W0,-xpmainditty.cԀ p XX to\\@- < E  NSP Y5'_$$6*ePP6dm:rDD;{;; < FF ;\PBTb _0 _ _` a  07070100060e1d000081a400000000000000000000000136434ea900001bf1000000ad0000000400000000000000000000001600000004root/tmp/pcxx/ditty.1. . ident "@(#)ditty.1 1.5 96/06/04" . .TH DITTY 1 "96/06/04" .SH .SH NAME ditty \- set/display Digi tty communication options. .SH SYNOPSIS .B ditty [ .B -a ] [ .IR option \ ... ] [ < ttyname ] .SH DESCRIPTION .B Ditty sets and displays tty options for Digi Avanstar, SmartPort, ClusterPort, PC/Xr, PC/Xe, PC/Xi, EPC/X, Xem and C/X tty interface boards. .LP With no options, .B ditty displays all Digi special driver settings, modem signals, and all standard parameters displayed by .BR stty (1) for the tty device referenced by standard input. .PP Command options are provided to change flow control settings, transparent print options, force modem control lines, and display all tty settings. Any unrecognised options are passed to .BR stty (1) for interpretation. .SH OPTIONS .TP 13 .B \-a Display all of the unique Digi option settings, as well as all of the standard tty settings reported by .BR stty\ \-a . .PP The following options specify transient actions to be performed immediately. .TP 13 .B break Send a 250 MS break signal out on the tty line. .TP 13 .B clear Clear the tbusy flag in the channel structure to free the port. .TP .B flush Immediately flush (discard) tty input and output. .TP .B flushin Flush tty input only. .TP .B flushout Flush tty output only. .bp .PP The following options specify actions which are not .IR sticky . Their effect is cancelled when the tty device is closed, and default values are restored when the tty is subsequently opened. .TP 13 .B stopout Stop output exactly as if an .B xoff character was received. .TP .B startout Restart stopped output exactly as if an .B xon character was received. .TP .B stopin Activate flow control to stop input. .TP .B startin Release flow control to resume stopped input. .TP 13 .RB [ \- ] dtr Raise (drop) the DTR modem control line, unless DTR hardware flow control is selected. .TP .RB [ \- ] rts Raise (drop) the RTS modem control line, unless RTS hardware flow control is selected. .TP .RB [ \- ] dsr This is the current DSR status. .TP .RB [ \- ] cts This is the current CTS status. .TP .RB [ \- ] cd This is the current CD status. .TP .RB [ \- ] ri This is the current RI status. .TP .RB [ \- ] rtspace Enable RTS hardware input flow control, so RTS drops to pause remote transmission. .TP .RB [ \- ] ctspace Enable CTS hardware output flow control, so local transmission pauses when CTS drops. .TP .RB [ \- ] dsrpace Enable DSR hardware output flow control, so local transmission pauses when DSR drops. .TP .RB [ \- ] dcdpace Enable DCD hardware output flow control, so local transmission pauses when DCD drops. .TP .RB [ \- ] dtrpace Enable DTR hardware input flow control, so DTR drops to pause remote transmission. .PP The following options are .IR sticky . Their effect continues until the system is rebooted. .TP 13 .RB eia232/eia422 By default, each port on an Avanstar configurable connection panel powers up in EIA232 mode. This option sets the EIA mode for the port to either EIA232 or EIA422 mode. (Option valid for Avanstar configurable panels only) .TP 13 .RB [ \- ] printer Forces the port to stay open so that non-sticky parameters such as baud rate and flow control are not reset to default values. .TP 13 .RB [ \- ] fastbaud Alter the baud rate tables, so that the following baud rate changes take place. .TP 13 For PC/Xx and MC/Xx boards: 50=57600, 75=76800, 110=115200, 134=14400 and 150=28800. .TP 13 For XEM, Xr and EPC boards: 50=57600, 75=76800, 110=115200, 134=14400, 150=57600, 200=230000, 300=76800, 600=115200, 1200=230000, and 1800=28800. .TP 13 For C/X boards: 50=57600, 110=115200, 134=14400, 150=57600, 600=115200, and 1800=28800. .TP 13 For Avanstar boards: 50=57600, 75=76800, 110=115200, 134=14400, 150=57600, 300=76800, 600=115200, and 1800=28800. .TP 13 Fastbaud does not apply to SmartPort boards. .TP .RB [ \- ] forcedcd Disable carrier sense, so the tty may be opened and used even when carrier is not present. .bp .TP .RB [ \- ] altpin Switches the function of the DSR and the DCD inputs on the modular connector, so that DCD is available when using an 8-pin RJ-11 connector instead of the 10-pin RJ-45 connector. .TP .BI maxcps \ n Sets the maximum Character Per Second (CPS) rate at which characters are output to the transparent print device. The rate chosen should be just below the average print speed. If the number is too low, printer speed will be reduced. If the number is too high, the printer will resort to flow control, and user entry on the CRT will be correspondingly impaired. Default is 100 CPS. .TP .BI edelay \ n .B edelay is a tunable parameter used to set the number of milliseconds of delay between the time the first character arrives after a period of no characters and notification of its arrival to the host. This is also referred to as the wakeup rate between the host adapter software (FEPOS) and the host device driver. This has the advantage of reducing host overhead by allowing the host to process larger blocks of incoming data. Larger .B edelay values result in more characters being sent in a given time period. This will reduce host processor overhead and increase overall system thoughput. Smaller .B edelay values result in fewer characters being sent in a given time period. This will increase character response time and increase host processor overhead. The default value for .B edelay is 100. This is a good value for normal tty activity like typing. For some applications like .I uucp, decreasing the .B edelay value may increase character throughput, but will result in increased host (system) overhead. For applications receiving continuous input at high speeds, increasing .B edelay will result in lowering host overhead and increasing overall system throughput. A value of 250 is reasonable. .TP .BI maxchar \ n Sets the maximum number of transparent print characters the driver will place in the output queue. Reducing this number increases system overhead; increasing this number delays operator keystroke echo times when the transparent printer is in use. Default is 50 characters. .TP .BI bufsize \ n Sets the driver's estimate of the size of the transparent printer's input buffer. After a period of inactivity, the driver bursts this many characters to the transparent printer before reducing to the .B maxcps rate selected above. Default is 100 characters. .TP .BI onstr \ s Sets the CRT escape sequence to turn transparent print on. An arbitray octal character xxx may be given as .BR \exxx . .TP .BI offstr \ s Sets the CRT escape sequence to turn transparent print off. An arbitray octal character xxx may be given as .BR \exxx . .TP .BI term \ t Reads the .I termcap file, and sets transparent print on/off strings to values given by the .B po/pf attributes found there. If the attributes are not found in .IR termcap , internal defaults are used for the following terminals: .BR adm31, .BR ansi, .BR dg200, .BR dg210, .BR hz1500, .BR mc5, .BR microterm, .BR multiterm, .BR pcterm, .BR tvi, .BR vp-a2, .BR vp-60, .BR vt52, .BR vt100, .BR wyse30, .BR wyse50, .BR wyse60, .BR wyse75. .SH "SEE ALSO" .BR stty (1), .BR ioctl (2), .BR termio (7), 07070100060e1e000081ed000000020000000200000001364c8e54000225f4000000ad0000000400000000000000000000001200000004root/tmp/pcxx/dpaELF44"4 (44WO؀,,Y/usr/lib/ld.so.1aykfkpTlRBis2X ljcGd?]SuqH[LQo#CQbS%O>1g-J\h3**IN<eP^rMoqN._~tmVWmYL v+xK1; +gV=xeA2&"`u:Z@)w}?/n)[t%HT0 F5j ,P'U4D85-D(:@6aACZv"'YMi<nK7_#U4rByG9f$Jchz,dwXF/{p`.| \$E^(s6O9&>=0;W 78R!]a3IEb!ԀXp`  p   (GW,YYYZ@4j p[!Z+ P 7hj@JQX@^Zf m@tTj}t D`D  H l LjhlH[pP  tPx[,ī0[>HRȫZ fZk`m\% {Z[ iiii̫ip[iiiЫj pԫ%!*|i4 A[OWej t zj@  `[Zjث@[`d( pؾܾ(44[=h[K0[UYp`[nu|j" xi/ p' [ @p $Hj2P8 @ Gl[U( _f<[pxZ<  \[t Ь h  [P l  +2[@KY  d[q$Qw,ZP[ l `D x|\ P[P  `d[$8[.[=([E,YN Z( eii o0v F 8P Z`00Z[[[` [[[*[8@EPM TZe nZ}=  j$j0 ( [P(,0 *[8 G4POZ!WX[`gPo w}Pf [Z[@ Z, T `  `  4Z x   $ . 6 0ZH p U Z e j |[z  ^@   < [  Z X   u   I   9& ` @ F pM PT ] n ,[y [  P  t[ p  D[ [  G  [ $[   X=X XX XXiXg XX$X5(X,XU0X4X8X5W%W%Wh%Wh%Wh%Wh%Wh %Wh(%Wh0%Wh8p%Wh@`%WhHP%WhP@%WhX0%Wh` %Whh%Whp%Whx%Wh%Xh%Xh%Xh% Xh%Xh%Xh%Xhp%Xh`% XhP%$Xh@%(Xh0%,Xh %0Xh%4Xh%8Xh% 4=#t(jhV #tjh(V #uGh0Sh<WhLhhXhhhEh|ShWhhhhhht}=Zh5īVh5ī Sh5ī Wh(5ī hh@5ī hhT5ī hthh5īi 5ī[^_ÐUWVjuVhTj #}EEfeVhTj #}jjj5hu#~ *@hv#~ *hv#~ ++=|jWvP F|(=|H ^_ÐU=jtj?jÐUWVSu3+++Ћ=(QRPj WEjjjB PWjjW jjjA PWjjhA PWhvh$Wi PjWjjhA PWujjWuWW$=Nu,+jN jYWW}=Yt"t=Zt`h5īuh5īn #t  v (vPh5īE 5īWjDuI<$u<<$D[^_ÐUWVSuxЫfBȋ+EfBȋEEuuWjPEujjj? PSjjS jjj? PSjjVt? PSrh4vh0$S PjS{jjV6? PSTujjSTfCh+ujj V> PShDvujSjjV> PS=Zh5ī5uh85ī 55(hP5īuuhl5īWjh5ī5īCuXjjSjju4?SIu$[^_ÐUWVjjj= PuVfFH;}^WjVT =tVWfFHPV( =tVGfFH;|fFH;}^jWV =tVfFHPWV =tVGfFH;|jjV =tVMfFHPjV[ =tV jfFHPV. =tVfFHPfFHPV =tVjjj; PV^_ÐUWVSEEE}5 }5 󥍽\5 5$V]$jV }WF$jW{ EP/$jEPa \P$j\PA u #Rj<EV@P&MVPVEuE#}MME]PS#u jVt@PV^MȉMPV4GE0E#u]EE}P+EE܃}|MIEܙ +EU܋<+} }}uMAEܙ؋;UuG EH;u*FW^OE}uE[^_À}u*+‹+++F#}~#|#~6hEP;}}h$EPG;}|#~6h,\PC;}h4\PG;|#~-h<}W ;}hDWC;|EP}W+;]}7EHE؋EEԋu4Wm;]} EPW[C;]|܉u썅\PWB MEDPhLu ]+;}4F;|sUWVSjjS8 PuVffFH;}RWjV =thVWfFHPV =thVpGfFH;|fFH;}RjWVj =thV5fFHPWVD =thVGfFH;|jjV =thVfFHPjV =thVjfFHPV =thVfFHPfFHPV =thVhjjS6 PV[^_ÐUWVSjj S{6 PuV+fFf;}KWjV/ =t j VWfFHPV =t j VGfF;|+fFf;}KjWV =t j VfFHPWV =t j VGfF;|jjS5 PV[^_ÐU WVS}fGfG+;}@U UM+;}+EVuW< =t uW F;|ۋE@;E|[^_ÐUEf@ȋU B+#}+ÐU5@b5@dÐUVjjj4 P5|hdvjj5|hvjj5|hvjj5|hvjj5|h$wjj5|hXwjj 5|thtwjj 5|]hwjj 5|Fjj V3 P5|hwjj5|jjV3 P5|5|j5|4555Ы5|5|55|^UtWVS+u5hjhPhP\#uoPhV{ V~A]jjpV'ulug$o[^_ÐVjPS #tGVjPS #uVjjjNjPE}ujSjjj1 PSjjS PhwPIPjSjjj1 PShwNjjjw1 PSuE #u+hwh,$SPjSw&PhxP$SPjSOjjj 1 PS'jjE}EE]}jjj0 PuuEVjPS& #tUuEESLƄSh xjWuw}ujPS #uEEujjj'0 PuCj5 5Ы 5Ыojjj/ P5Ы} }8Ejhxh$ 4hhTxh$jhh4xh$h$j5 5ЫjjjP/ P5Ыi5ЫuE=QtA== }EEEEQE+E t=jQhDx}~qEV4;]}}VjPP C;|lE9Eg$=i=Nt=Pt}Q}Qg}q]}/N=nt=pS=q=Rt=S6UV5VVhm#u:hhW#u$hhA#u   ^ÐUWVSVhxVh=Zt=īu hdx=x=j jjȋ%;tSɋ=Z4t=Yu+7-.|&=w$\=w$VQGfC;bEEVj EfC9E;ptu Vj nVj c[^_ÐUWVSffUU+u Ejjju <#!}Ыf@ȋ+Pj Vj PE}tujVOhxl }M]]E Ejjj| PVzj VjjVr uhP PjjVghyjjVUhyWjVDh,yWjV3hDyWjV"jjj PVVa=QPt)=Au>hhEPV:EjjG =Ot=at=ot=qt"EE ]uu4$&"t/zu hW WgEPu d#tV5pVuu h$Wl Wo4$+jj_[^_ÐUWVSE+55$jj5$ jjV. P5$'5$GM|jj5$ =t5$jMj5$ =t5$TjjV P5$5$Qg ]]h5ZdobjjV9 P5$2hTyj j5$Kjjj P5$hhyjj5$hyjj5$hyjj 5$hyjj 5$hyjj5$jjVv P5$ohyjj5$hzjj5$qhTzjj 5$Zhzjj 5$Chzjj5$,jjj P5$Z+x[P [+t[P[+p[P[+l[P[+h[PZ+d[Ph{jj5$(`[+[PT[+[P([+[P$[+[P,[+[P[+|[Ph4{jj5$Q(<[+[P[+[P [+[P[+[P[+[PhX{jj 5$$X[+[PP[+[PL[+[PH[+[PD[+[P@[+[PZ+[Phx{jj 5$,8[+[P\[+[P4[+[P0[+[Ph{jj5$L jjV P5$Z9Zu#Z+d[Ph{jj5$[+|[tPh{jj5$,[+[tPh{jj5$$[+[tPh{j'j5$([+[tPh{j1j5$lT[+[tPh{j;j5$G`[+[tPh{jEj5$"[+[tPh{jj 5$[+[tPh|j j 5$ [+[tPh|j+j 5$[+[tPh|j8j 5$<[+[tPh|jEj 5$iZ+[tPh |j j 5$D@[+[tPh(|jj 5$D[+[tPh0|jj 5$H[+[tPh8|j)j 5$L[+[tPh@|j2j 5$P[+[tPhH|j;j 5$X[+[tPhP|jEj 5$f0[+[tPhX|jj5$A4[+[tPh`|j!j5$\[+[tPhh|j-j5$8[+[tPhp|j:j5$jjV  P5$5$"+jjjX  P5ЫQjhx|h|h|h4=$W<Wj5 5ЫEjjj  P5Ы5ЫZjj5$`=Qzt$== =5a5$5$EQKZd[[h[[l[[p[ [t[Zx[[|[,[[$[[([[T[[`[[[[[[ [[[[<[[Z[@[[D[[H[[L[[P[[X[[0[[4[[\[[8[[*hD5$5$zbmj5ijjj  P5Ыݾjh|h|h|h4=$WWj5 5ЫѾjjj  P5Ы褾5ЫW=*==?E9=Z=q=z= =Z}Q[^_ÐUTWVSZ H~eRh<uVv Vy++}Ph( 5ī) 5ī蛼wtu;5(~KuhuV Vh|M#tZ Hu#t uF|E8tjjjNVļP˼Sнjjj PW趼jjW蹼 jjj PW豼jW=Zt~h5ī uh5ī Vh 5ī E8t } }Ph 5ī赺 #j(}e[^_ÐUWVSu5Z5%jjW P50觻h8}jj50jjW{ P50蔻 ZɍA(PhX}jj50wjjW2 P50+hh}jj50DjjW P50 ZɍA=Á0#t#~h(h|}jjPٺh}jjPź#tj+Z ҍ JI;}Nƍ xQHQpVh}jP50q ZɍAH;|jjW P50 0#t&h}j ZɍAP h}jjRjjW P50͹0# ZɍA xQh}jPR芹h~jj Rv0#tu+ɋ5ZVN;}Y5~ϋ< <WyWyWVjL QPZPI0;|jjP苷 jjV P50蚸+50/GM|jj507 =t50jMj50 =t50ŸjjV P50jjj P5Ыܷjh8~hD~=4W5$VVj5 5Ыӷjjj P5Ы覷505Ыڷjj5=?=|= g 0hDQ50ZBM55謷$/504Qj5ijjj P5Ы芶jhP~h\~WVVj5 5Ы荶jjjG P5Ы`舶蓶y==/ 0hh~j ZɍA ~  P5ȫz+ ZɍA;ojjh P5ȫ艭+Zȫ+ލ ҍ JT;RQP$ =t5ȫGZȫ ҍ J|]UURQPʫ =t5ȫ芭jjj P5ȫ转hH  ZɍAƍ@P?~#uaZ;=ZtH;uzjjh T P5ȫMXjjh 2 P5ȫ{6jjj P5ȫ Z;u=ZtH;tEP ZɍAP5ȫ葪 =t/ ZɍAƍ@P5ȫkZ H2 E܊E}u }u"t5]MPhtuR5ȫDjjh P5ȫEP ZɍAP5ȫ蒩 =t= ZɍAI;} P5ȫ.jjhe P5ȫ~ ZɍA;jjj( P5ȫ! ZɍAȫN~#xPh|jQR hjQR+Z ҍ JJ;}Z5NjRPRxWVjDP5ȫ虩Z HH;|jj=Z}hP 5ī躧 ZɍAh 5ī蒧 ZɍAh 5īj +Z Hī;}`=  RRRQVWP FZ Hī;|P\}t#E5Ы葨5p胨5ȫu5臨=j=6== 襾 ZɍAZ#tHZZ=Zu#u ZɍAZb@ZV;|Z< Z05ݧU`5ȫe5ǧ5ȫɧHZZ@Z55ȫhDQ 5ȫէ车Ȧ}ZZ ҍ J=Z;ZZ ҍ J=ZtZZ;jjj P5Ыϥ ZZP=Zt DA#jtThh hhh(h<hhhhhhh4h$O$-hHhThh`hth4h$ h$j5 5Ы%jjj P5Ы5Ы:Qtqt [^_Ð5q5ȫZ#Zusj5i'5ȫ补5ȫ裤5epwL Z=ZtZҍB|y#t5ZҍB8tWjjj|#u ZɍAfujjjl P5ȫehjS =uS ZɍAD0P5ȫ# =t5ȫjjh P5ȫ3Z HߊQh$u܍D0 P5ȫ ZɍAM;sujjhz P5ȫsh0j ZɍAED P5ȫqjjj+ P5ȫ$Z H5ȫE| ~#xPhDjWV h`jWV+ɋZҍBJ;}`luϋRQRyWSjƍD P5ȫ藎 ZɍAI;|ujj=Z}h 5ī贌 ZɍAh !5ī茌 ZɍAh !5īd +Z Hī;}`=4! RRRQVWPFZ Hī;|PV}t#E5Ы苍5p}5ȫo5聍=jY=tR== 裣Z ZɍAZ5A蹌Č5ȫɌ5+5ȫ-9HZZ@Z^5S[f5ȫkhDQm5ȫ7*Z=Zt ##tH ZɍAZZ ҍ J=Zt;;@ ZZɍA=ZtZZ;ujjj P5ЫZZ H=Zt DB#jtWhȂhԂhhhh!hHhThh`hphh4h$_$-hhhh(h<h4h$0 h$j5 5Ы5jjj P5Ы5ЫJQtqt [^_Ð5聊5ȫ Z#UZuQj5i75ȫ豊5ȫ賉g5u耉臿= Z=ZtZҍB\Y#t5ZҍBtSjjja#u ZɍAfujjjx P5ȫqhj=!QVWP~FZ HfСī;|P8}t-ES^5Ыc5pU5DGjj苠5M=QH==0= kHZZ#u ZɍAfZ@Z ZɍAfȡZ;|ZhD5Dp5D:5D<bHPj WTjjWFj5il45T5D讄~~5D~jjj? P5Ы8~Z ZɍA#jtThhhhhh4h$ Mhhh h4h$΍'hhh̄hh4h$襍h$j5 5Ы}jjjd P5Ы}}5Ы}5D}Qtqt 0[^_áZ#tEHZZ@Z5}I}T}/5$}ih$jvԫ#u+hh!h(v juԫ+;Yuؾ#t,;}(5xx- xܾ#t+;|ڡhxhdPIv #FE=Zh "5īkuQhj?SPvfPhjGS5vjjj{ P5tvEPhd$ثP u EPhl$Pt |ffE;ԫ==Z5%ht$5ītt5ؾh$5ī[t 5ܾh$5īBt ī= u5h$P t ī5VP t +;ԫ+4ۍ4sPWSh4%5īsfPShX%5īsG|ثPShx%5īsPSh%5īwsSh%5ī]sSh%5īCs PSh%5ī%sfPSh &5īsC;ԫ5īks=xijjj( P5Ы!tjhhhhh̆h4h$ h$j5 5Ы tjjjÿ P5Ыs =t5Ыt5sjj?5t=Q9 =  =;=  &HZZ#uԫHZ@Z ԫIZ;|Z5s5rjjJth؆j7j5r5rjshj7j5pr5r)f=u j{5QrYrdrjjj P5Ыq=xijt/h@hhLh\hph4h$軁 (h|hhhh4h$葁h$j5 5ЫqjjjP P5Ыiq5ЫqQtqt C[^_fȀ8ff$f@u<u h,"h@"hT" <thh"EPo<<~fLJ&f$h"EPJo<<~f$f&h"EPzofLJ$ff&fLJffh"P0oƄa<<~0th#EPofLJ$7h|"EPn<<~fLJ$fLJ&jV}ff%u6f$tOh #h# h$#h,#EP7n%f=tf=@tf=th8#EP`n"u7hD#OhL#Gh\#?hl#8h|#/h#'h#$<t<t<t<t<t<th#EPmfȀ8 N$<D# ؾ*1204 f8h0hbe5m #h#h#EPim^u6h"EPDm<<~fLJ$fLJ&jT f$<Mh"EPlH=:hfLJSEPlh#EPlh#Slh# EPl4f8:;<=h0hbe5}l #tNfLJh#u lh$ulh $Slh$ukZ+ۊ: <h$hT$QkhD$Qkf@fƀ =t=uhL$Q_kf@fƀ}h$$Q-kf@fƀƄfLJxi0h4$Qjf@fƀ#t _fԬf֬C^;5Zu)jjh _ P5Xkh$jjj9 P52khjS5LkFEPhPjS5/kEPhXjS5kjh\$EPi #tGjjh 赶 P5jEPh`jS5jjjh ?jjjq P5jjEPhhj!S5jjjj: P5Sj;5Zujjjjj P5j5|hpj)S5j5hxj3S5i  jh=k=`=t=u6h,$Qhf@fƀM=^=h<$Njh@& ZɍAPg #kZPf$ f=uxQif=tf=t f=fǂZQHi5Lj ZɍAثPj#hH& ZɍAثPYj#^hT& ZɍAثP.j#3hh& ZɍAثPj # Qqhgg ZɍAf$f=HjI hDQ5h5g)=xihj2i\[5Bi`[^_ÐUWVSZ;u5ؾ+Έ 1120Xf$f=0f=t f=4@ f58WhbeRfb #t ZZZZ5>WhZZZ5B:hZ5F'hZZ5Jh[Z5Ng[Z5Rg[Z5Vg [ZZXZM=ZuCf֬Cf֬4f58W=:+ _WhbeRa #tCZ=Zjuh0'h8'Z ҍ J@P?a fBPf} fGfDPffG fFPffG fHP|ffGfJPiffGfLPVffGfNPCffGfPP0ffGfbPffG(fdP ffG*ffPefG,fPefGPGTG_ ZɍAff ff@f&f$u)f5̫f= fhf f'f̫f f=hf f5[^_ÐUWVS];u ؾ*11204f8h0hbeR^ #t)+=@'jWvP@_ F|+<ۍ<{;}5v:juhH'hP'P^ F;|+;}@ ƍ@BjuhX'h`'P^ F;|[^_UWVS =$jjS赪 P5Ы^jhWn Wj5 5Ы^jjSr P5Ы^5Ы^jj5^-tjj~tQt qN[^_U8WVS+57^?^J^5ldjjh P5l]hj j5l]jjh芩 P5l]jj5lA\ +5l^GM|jj5l\ =t5l]jMj5l[ =t5l]jjj֨ P5Ы^hj5 5Ы\jjj螨 P5l\5l\5Ы\C+Ƅ|A@=|ƅxEZ@PShHjV5lo\htjj5lS\5l\P5ZhW* l=f= hԈjVQ\5l4\V|P5Zh, l#h,jjQ[hLjj5l[5l[jVPW5Zh10 l =hhjjQI[5l{[4$P|PY l#Ph jWQ[5l8[jjj貦 P5ЫZjh<5$Vj Vj5 5ЫZjjjh P5ЫZ5ЫZj j{5Zluh`jjPKZ5lhjjP-Z5l_Z5lLZjjjƥ P5ЫYjhVi Vj5 5ЫYjjj肥 P5ЫY5ЫY5lYiPhjVQgYjj W P5ЫYjh5$Vi Vj5 5ЫYjjWԤ P5ЫX5Ы/Y5l!Yjjey5l'YjjKyDPhjjQX5lX5lX5ЫX5YXXhh'5īVh'5īVSh'5īV Vh'5īyV 5īVPhpjjQW5lXE|hȉjWQWhjj 5lW5lWq5lW5ЫW5WjWuW=Z[^_ÐUtWVS'8'hT(pPPEhl(pPPE ZɍA09]t[;Whd(4SeP SpPeP ZɍA0ȋE;iGEEWh\(EEWh(4WO WpPOEEEE9]'݊1HEv+҉DE;H[UUċDŰU؉U ]ЋUȉŰZUԍSUЋUBU;]UčTEĀ}uht(4WO WpPOZ H<119EZ9]uŨ;9]uh|(pPN;h(pPNEh(pPNEZ H<119EU9Uuh(4W'N WpP'NZ H<11Ũ;\HEĉEEE슄1EĉEuh(4WM WpPMZP<2EE슌22H,9EHEĉEEEHEpP1N#th(pP MEEZP2@29}MMMMEE@ ]MM ZMKMMAM;] MLE}uh(4WNL WpPNLZ H19}Z9UuE;9Uuh(pPK8h(pPKEh(pPKEZP229}M9Muh(4W_K WpP_KZ H1E;]EEEE슄11EE슄22gEEuh(4WJ WpPJZ HEE슄111K9}@EEEE싅@ EpP/K#th(pPJ+Z ҍ J1;MME|Ah(pPI ZɍA09UߋEEZ{MAM;t܋MLE|Wh(4S8I SpP8I ZɍA09M/Z;uE;;)h(pPHDž|9U;!Wh)4SH SpPH ZɍA0ȋE;h )pP]HDž|pPZ@Phȋjj5lIhjj5lI PpPGjjj# P5ЫIjhpPh(h4h$Yh$j5 5Ы IjjjƔ P5ЫH5l!I5ЫIjjWi5I=5%?== lhDQ{5lI5lHxHHh4j7jQ=H5loHjHhDj7j5lH5l@H0j5i`jjj術 P5ЫGjhXpPhdh4h$Wh$j5 5ЫGjjjD P5Ы]G4ƅ54SE5GH,v%%4ƅ5-p@Ph$jj5l>5l> hjWQ> l hjVQ~>5l>=ZtUh*5ī<Ph +5ī< Ph +5ī< 5ī=h)5īd<Ph)5īJ< 5ī<=[Fl@PhjjlFAQhjjZlFA=t=uQh$jjR7=5li==ZFuhXjj5l<5l%=+ۍVt<$V|> hVR<9hPPhjj $=#C|}GM@PM@Phju5l6<5lh<P;$PM1> ؍P;;wSM@PhDwSM@PhtjWuFh@Ph|juluFAQhjuWluFA=t=uQhjuR4;5lf;=Zh*5īv9Ph8* P:$PM< ؍P[:;MPPhj j<"=Q# lwMA=uRQh̐jWRL:5l~:=Zhd*5ī8Ph*%=tlwMAQhlwMA=t=uQhjWR95l9=Zbh*5ī7Ph*MPPhjj!=9#QEdxEtE]uE\Et5l>jjh覄 P5l8hDjj5l8jjho P5lh8jj5l&7 +5l8GM|jj5l6 =t5l8jMj5l6 =t5l8jjj軃 P5Ы9hdj5 5Ы7jjj胃 P5l|75l75Ы7d+ƄAƄ@=|ƅƅ @P@Pdhjj5l57hjj5l75lK7hP!9 l=hHjWQ6hhjV5l65l6PPhjj=e#P5 l=h jWQ365le6jjj߁ P5Ы5jh<h$E h$j5 5Ы5jjj蓁 P5Ы55Ы5j j2V55u uuh`jj5ll55l5J$ l=t =:ދjjj P5Ы4jhh$D h$j5 5Ы4jjj蝀 P5Ы45Ы4j>5+`\# =tFh4+5ī2hX+5ī25ī73`F@Phj`5l45lO4P3$P6 \Pv39\tIFX\@PhjV5l35l3X`GTj3+P=tP=tI=Zt@h|+5ī1h+5ī15ī1TF@Ph,jT5l25l3Pe2$P4 PP;29PtAFLP@PhXjV5lf25l2L=tP|4ǃ844GT\#T먐==ZSUWVS+EuVu fF f9F t!hx,h,u'0 fFf9FuފNT"V_fhf̫ f  f Ät1h,h,h,u/NT"V_%ZۍCf$uuuf$f Ät4h,h,h,u_/f$NT(ZҍBf$uuuth,u/NTfhth,u.NTfF($t f̫u"u)f th,u.NTfF($"t f u"u"f̫th,u{.NTfth,uY.NTfth,u7.=ZtOh,5ī-Wh-5ī- ī#tuh-P- īP:.[^_UWVS}~e=Z h,-5ī|-hH-hT.5ī`-hp.5īM-5ī-uVu EZ;u ؾ*]]ƅ^ƅ\fFEMZۍS=ZtBf֬E EEfF Ѝ:fF;f+@fdE+}fV f#VU`+;}}9=fGfd;|UʉMf#\Phbeu, #=Zh\-5ī+Shx-Ph-5ī+Sh-5h-5ī+Sh-h.5ī+Sh4.5ī+ 5ī+l`+XE`f~ H9E~O}}fdMf}+;}U f@fd;|Mf}\Phbe5+ #tt=ZfdfF f#FE`+;}ъ f@;|\Phbeu.+ #t=ZdE `fDždfN ffFf#P0ff\Phbe5* #t=ZZ[^_Ðf^ f;^ } f;F zVWfF f;u=ZMDUWVSEEuV] SRfFE} fF9E~e=ZLh.5īL)h.h.5ī0)h /5ī)5ī)fMMfFf;Eu6}EE#j*OVSfFf;EtًMMM;t%j*4$SdfF;u݋Uf;Ev+fF+|8;}~r=ZK=Zt4h.5ī?(h.5ī,(5ī(+ UE[^_Ë MZ; u ؾ*aƅbƅ`EMf9NdfF+Ffh+fh;}Ƅj@fh;|鍅`Phbeu( #G+;}Ej B;|E]ދEdf+fh+;}Ƅj@fh;|鍅`Phbe5' #+fh;ÊjBfhȍ;|fh+fh;}Ƅj@fh;|鍅`Phbeu' #K+;LUuj @;|-UWVS =}ujh(/WO&lZ@PhT/W% SE @PZ@Ph|/W%7E @PZ@PZ@Ph/W%}t}t}t5hjP%5jPg%h/P(5,&&&W5j??&&5'5&3E}t4++;5}(h/<P'#tCF;5|؃}t#5,jjhq P5%WhW%$5f<Pj5%hjj5%jjheq P5^%jj5$ +5%FM|jj5# =t5%jMj5# =t5w%jjjp P5Ы%hj5 5Ы$jjh vp P5o$ j=Puh8jjQx$ShTjjQa$+;5}/=PWjS5-$FC;5|jjh o P5#jjjo P5Ы#jhhh45$V3Vj5 5Ы#jjjio P5Ы#5#5Ы#jjC5#+;50S<P$#F;5|}j5j;#)#5$5 #E9; hDQV5#5"""=$E5(jjh5n P5."hhh!$58Pj5("hjj5"jjhm P5!jj5 +ۡ5D"CM|jj5L =t5 "jMj5 =t5!jjjm P5Ы]"hj5 5Ы"!jjjl P5 +;EEE;ujjh jjjl P5 E@E <PPh8ju5 ;u jjh jjj1l P5J C;^jjjl P5Ы jhHhhThhh4W/Wj5 5Ыjjjk P5Ы5 5Ыjj@@5 =QP= ==  htj5,`[^_Ð5jPz<PPhP#uJPh$0 PhH0dV Vhx05 5jPPP|h P(#x5}u$ԫHPjZPPP}t}ZEP] tO+ ;}=EVSPh #FZP;|ЉE슄tqMɋ}]7VuW  #F=ZWEM芌 Ɋ;|]}슄M񊈗΋}]GVuW #F=ZWEM  MMˊ;|]܉}슄񊈗֊ʋU]Ԋ;{VuR #fFuЋZ4ҍ4r>>>MȊ>MMu΋u듐===?8=-W=jL=k =qn==  =ZU$WVSME ;E܍<ɍEEEVuu #F;|ۋEEEt]4ىEEE CȊ;}Suu #t$EEE슌ttъʋEEEFʊ;}Vuu #tEEE䊌tq4يӊʋىE CȊ;}Suu #t&E@;>MA;M[^_ÐUWVS+ۋ}M+ҋE;} B;|#."#tuui#t+[^_Ð=u#u2< u"jWV =t#uM}~< tڋEEGC9]~uu #t랋uU UUUM}E럐U0WVS EEf0fU0UVh500`0d0X0\0L0P0Tf0fJ1uuuh2.uuuh82uuuhp2uuuh2tuuuh3\]؉uuuuhL9>uuuh;(uuuh>uuuh@WX MM܋MMMM]uuuhl1W EiMĉMuuuuhd=W ]:MMMĉMuuuh=W ]uuuh:W =Zt;h;5īl Ph0;5īR 5ī Vuuuh3W- }hl45ī Ph45ī 5ī\ <j5j%n y 5n5p  h1 = =  =hjh`35īPuh35ī{5īhjV5 5 4Pe $4Pu 4PB ;uP`Phjj =#=Zt>h45īPuh45ī5īshȘjS5 57 P$Pu Pe;uP`Phjj =#=Zt>h65īPuh 65ī5ī1jhH6P #jhT6P #uuuܡPh\6WK=Zh65īPh6=t =&uuuh,4W=Zuuuh|5W=ZIh55īzPh5 =t=^ h6h75h<8+WS=rW==wWSl<PSjjj R P5#u hh$jVP&jjjQ P5jjjQ P5Ыjhdhphh4h$h$j5 5ЫjjjhQ P5Ы5Ы5jj%5=?tR= gv+r hDQw85A5C&6j5j 55"UjjjsP P5lhjV5jjj@P P5Yjjj#P P5ЫjhHh$ h$j5 5ЫjjjO P5Ы5Ы25$#t^hxjV55Eԋ=W<| u h8h9EPZEPE }u]؋EԉEЉ}̋EEuhjuQ$5VuM̉LM̍H)M+ۉEjPV@ EPbE;VW`Phjj =Q#=b"tYjh6P) #jh6P #QuuuܡPh7Wy=ZhD75īIPhd7jh7Pu #jh7PL #tmuuuܡPh7W=Zhh75īPh8"t< t < tG"u"t< t< uG"u+Ɋ" < < A"uuuuhH8W =Zh85īPh8^uuuh8WjjjK P5hjV5jjjK P5= ==k hjhT;5ī(Puht;5ī 5ī}^hjV5t5 P$ Puu P;Vuuuh;\]؉u=== uuuh<WA=ZhT<5īPht<=t=^uuuh<W=Z(h<5īPh<uPLPhjZjZI=#g=Zt>h=5īJPuh4=5ī-5īKMh jS555 =W| u hT=h\=EP.EPE#tMMċMMMM}VhLjuP5*<$؉DEC+jPu$ EEPE9EW1=s==Zt4h=5īh=5ī5ī=učPJPhjjk=#=Zt>h$>5īlPuhD>5īO5ī#MMUUMĉM]ChtjuP5 P$ Pu P;Vuuuhl>== =t =uuuh>Wp=Zh4?5ī@PhT?7uPXPhjj =#g=Zt>hx?5īPuh?5ī5ī/shjS5&5XP$Pu' ؍P;j^uhhP?E}^hܛjV55$P $$Pu $P;RVuuuh4@wWh jS55FWh@5\ 5jd}t uhPE[^_ÐU WVS}9u +ؾߍGu pf֬EE=Zt=h@5īuuVSWh@5ī5īh$Ah,A#=Zh`A5īThA5īAhA5ī.UhB5ī5hB5ī VWhB5īShB5ī 5īI,=Zt4hA5īhA5ī5īVEPhAV =u}Vr u fVWjo E}u_=ZhB5ī5h0B5ī VWhPB5īuhtB]S[uh!S6 Z=u#lc#t]hC5īzh(C5īgVWh 5ī+[^_ÐU(WVSuuVu ]SpV'=s =xCWVV=rS=s =CWSS=rEPEPhCVEPEPhCSME;;|ME;~;|+[^_ÐU$WVSCUfCfUE5jhCP hCP#tC+=C؍PWS =uF|܋P5#uE+;vEhjE MPM􍁼P5jhCVJhCVE}uLhC]hD h DEPM<PEPShDShDSM+]ShV #tV=tG|׉]:uV;}+=DjWP #tCV;|ۃVx;5+W^;}' DjS7Pu #tFW7;|W*M<;#7D7EW= PPh(DW=QPQPh4DS{D7 EPPhDDW=9PPPQPhPDS D7EW= tW=PPh`DW=QQQPQPhlDSq u=WE@hDPF#C}t uEE;=ZtwhD5ī5hD5ī +ī;5}3=D<QQVWPFī;5|P E[^_UWVS Z;u5ؾ+ֈ1 15ZZ<ɍ|jjQ =t5RjFj5` =t5 jj5. =t5jFj5 =t5jj5 =t5jFj5 =t5Xjj 5f =t5&jFj 54 =t5jjj.3 P5'hPjj 5@jjh 2 P5hd5jjj2 P5j.j 5~ =thl5tjjj~2 P5wj9j 55 =th|5+jjj52 P5. ZɍAf$f_fUfK5LjثP #) ZɍAf$Q詅jjh1 P5hjj5jjhY1 P5r ZɍAfPhjj5Q}p}jjj0 P5Z@Phjj5Z@Phd=lQ諄jjh0 P5hjj5jjj^0 P5W ZɍAh,jj5[ ZɍAh<jj5/hLj7j5 ZZ9 Z} %Z4[S5 Wj7j5 ZZ9 Z} %Z4[h5g }^}sjjj=/ P565Zhjj5Ijjh/ P5Z@Ph̝5 jjj. P5Z@Phq j j Ql =h hhh h`5<ZPfH$ f$u-"j j Qt =uE =u2"j j Qt =s =ejjj- P5 ZɍAf$ft)ft#ft5LjثP#hjBj 5PhjBj 5cujh - P5 ZɍA ZIPWjCj 5 jjj, P5jjh, P5jj 5Z =t5jFj 5( =t5jj 5 =t5jFj 5 =t5jj 5 =t5RjFj 5` =t5 +GPj 5* =t5G>|jjj+ P5ff9Ejjh * P5jj 5 =th5jjj* P5hȟ5`Z HZf$=ZuV=hD@P#jujjh * P5Z@=hD@P#jjjj 5} =f f9 jjh v) P5ojj 5- =thП5#jjj-) P5&2h؟5jj 5 =uϊ Lf$jjh ( P5jj 5| =th5rjjj|( P5u1h5@jj 5 =uϊ Lfhjjh ( P5jj 5 =th5jjj' P51h5jj 5i =uf $tLf ̫u" Lf jjh B' P5;j"j 5 =th5jjj& P5.h5j"j 5 =uf $tLf u" Lf̫jjh r& P5kj'j 5) =th5jjj)& P5".h5j'j 5 =uҊ Lfjjh % P5j,j 5| =th 5rjjj|% P5u.h(5@j,j 5 =uҊ Lfjjh % P5j1j 5 =th05jjj$ P54h85j1j 5i =uϊL" Wfhf̫ f  f Єtjjjh D$ P5=j5j 5 =h@hHhX5 ZɍAf$Gt>jjh # P5j5j 5o =u;j5j 5Q =tXhPh`5@j5j 5 =u L"Wf$f ӄjjh " P5j:j 5 =hhhph5xKjjh m" P5fj5j 5$ =:ZҍBf$tBjjh " P5j:j 5 =1;j:j 5 =tXhxh5505"55,55$55l޶5Ыж5D¶5贶5ָ5˸5x5=Zt5ī苴5īݶUWVShFhDS{u #t6hFh(ó jIhFV]SW ==G=?u\x5hDcjWhGhG%ī#%Z/Z#=dt=ft=lt=mt=rtWVS起 =dz蘼޺=jt?Q9`jE[^_ÐU]衰=h˲EE=  Eh褲EE=5h(GEPB= E 8EEP¶Ej:EPEE=]+]EP;WE+EPEPEP =5E@Ej;EP_EE= ULE@Ej;EP*EE=E@Ej:EPEE=Ch0GEPEE=Eh4GEP=h@GEPγ=[hLGEP袳=/hXGEPv=hdGEPJ=hpGEP=h|GEP=hGEPƲ=ShGEP蚲='hGEPn= hGEPEE=&=(%(== EEB=E ĦE EĦEE%="=E EEE EEEE;AE@;E ED;EE@EE;E;`= hGh(EU @EUDUEPE PBP @E@EEU ЉUE]S[:Btу:tQ[S[Bxу:tQ[Current Level = %d, Last feature =%d %d.%d.%dTERMxtermvt100wy?=Helph/j/k/l=Movej/k=MoveN=Next PageP=Previous PageF1=HelpArrows=MoveArrows=Move=Next Page=Previous Page ***** TermDepSetup ***** TERM = %s Help String = %s L/R/U/D Arrows = %s U/D Arrows = %s Page Down = %s Page Up = %s NA User Input ***** Debug info from AskYN ***** Question: %s Answer: %s Message Press ANY key to continue***** Debug info from ShowMsg ***** Error message: %s LINES: %d, COLUMNS: %d startx: %d, starty: %d height: %d, width: %d Option list is too long, need %d fewer characters%s%srError: File: %s does not exist DPA HELP unix3.22/dev/pcxxdl/dev/epcadl Download Device Error 1) Digi drivers are not loaded. 2) Need to reboot after installing drivers.Press ANY key to continue usage: dpa -f logfile ***** Debug info for line1conf ***** line1config string: %s nports_conc[%d] [0] = %d ***** Debug info for line2conf ***** line2config string: %s nports_conc[%d] [0] = %d **%02xff***** Debug info for get_config ***** line1config string: %s line2config string: %s display_config: %s AC***** Debug from get_config ***** Board=%d, conc=%d, ioctl failed ***** Debug from get_config ***** Board=%d, emm_conc[%d]=%d Adapter slot: %d line1conc: %d, line2conc: %d board type used for config: %s Conc %d start address is %d 9010181f10900888840409181f89088488040989unknown junk here: %s XXGGXPGGGGPXXXwFile %s exists,awError opening file %sScreen saved to %sYou have %d concentrators configured, the maximum allowed is 14Sorry, we need %d lines to display the information***** Debug info from CreateConcPanel ***** lines_needed: %d win_lines: %d condense: %s panel creation: %s ACAC***** Debug info from print_adptconf ***** line1conc: %d line2conc: %d nports_conc[%d]: %d %d %d %d ACAC***** Debug info from print_adptconf ***** line1conc: %d line2conc: %d nports_conc[%d]: %d %d %d %d ***** Debug info from print_Xemconf ***** slot: %d Module type[%d]: %s total %d nb1 %d nb2 %d nb3 %d nb4 %d The drivers installed DO NOT support %s. DIGI_GETBD ioctl failed! AccelePort XEAccelePort X?AccelePort XEAccelePort X?AccelePort C/X AccelePort EPC/X AccelePort Xr AccelePort Xem Avanstar AccelePort 2000 Unknown(ISA)(PCI)(MC)(EISA)UNKNOWNOKNOT FOUND NO IO NO MEMORY NO BIOS NO FEP/OSHD/W FAIL UNKNOWN FEP FAIL NO PORTS BAD BAD BAD BAD 0xffM4emM8em16em16em8emp8em ????OK%s%s***** Debug info from print_identify ***** num_boards1 (/dev/pcxxdl): %d num_boards2 (/dev/epcadl): %d num_boards3 (/dev/pcxrdl): %d num_boards4 (/dev/aspxdl): %d adapt_info[%d].modtype[%d]: %s adapt_info[%d].nmodules: %d adapt_info[%d].print_type: %s adapt_info[%d].bd_state: %s adapt_info[%d].ioport: %X adapt_info[%d].physaddr: %X adapt_info[%d].physsize: %dK adapt_info[%d].nports: %d OKAvanstarAccelePort 2000SmartPort***** Debug info from get_channel ***** channel: %d conc: %d line: %d rw.rw_board: %d rw.rw_conc: %d rw.rw_req: %s rw.rw_addr: 0x%x rw.rw_size: %d vvww**ACDNACDN***** loopback test ***** Data compare failure test_data: %s read_data: %s Ԋ = Second ChannelOKCONNECT 38400 AT&F ATE0 ATS64=10X3&D2 ATD ATA +++ ATZ %d, - %d%d, %d, - %d%d, , %d, - %d%d, , %d, - %d%d, ***** modem loopback test ***** send chan: %d, recv chan: %d send dev: %s, recv dev: %s ***** modem loopback test ***** Set factory defaults to chan=%d rsp=%s ***** modem loopback test ***** Bad rsp to surpress echo cmd=%s ***** modem loopback test ***** Bad rsp to set loop back mode, rsp=%s ***** modem loopback test ***** Bad rsp to dial cmd=%s ***** modem loopback test ***** Bad rsp to answer cmd=%s ***** modem loopback test ***** test_data: %s read_data: %s ***** modem loopback test ***** Invalid state=%d, channel=%d ***** modem loopback test ***** Invalid state=%d, channel=%d }`}`}`}`}`}`}`}`}`}`}`}`}`}`}`}`}`}`}`}`}`}`}`}`}`}`}`}`}`}`}`}`}`}`}g}g}g}g}g}g}g}g}g}g}:TX:RX:OFC:OFC:OFC:IFC:IFC:IFC:RTS:CTS:DSR:CD:DTR:RI ***** test_busy ***** Busy flag=%d Busy string=%s ***** test_send ***** Invalid length ***** test_send ***** copy data 1 ioctl failed=%d ***** test_send ***** copy data 2 ioctl failed=%d ***** test_send ***** copy data ioctl failed=%d ***** test_send ***** tx_head ioctl failed=%d ***** test_send ***** Data not moving ***** test_recv ***** Invalid length ***** test_recv ***** rx_head never moved ***** test_recv ***** too much data received System Wide em/Modem Flash ROM Load Adapter %d em/Modem Flash ROM Load Adapter %d, Conc %d em/Modem Flash ROM Load Adapter %d, Conc %d, Port %d em/Modem Flash ROM Load wInvalidInvalidInvalidInvalidUnable to copy loader file '%s'Unable to copy Flash ROM binary file '%s'%s No Modems Loaded /tmp/digi_fltmpOK READY REPROGRAM 0.ERROR AT&F ATE0 AT&F&W0&W1 AT-V-N REPROGRAM XSTARTUP AT#C#C0000# ..Flash ROM Load Canceled Prior to doing Adpt=%d, Conc=%d, Port=%d...Can't create temp device for for Adpt=%d, Conc=%d, Port=%dOpen failed for Adpt=%d, Conc=%d, Port=%dCan't find device name for Adpt=%d, Conc=%d, Port=%dFailed ioctl for Adpt=%d, Conc=%d, Port=%dFailed ioctl for Adpt=%d, Conc=%d, Port=%dSet Factory Defaults Write Failed To Adpt=%d, Conc=%d, Port %d, rtn=%dSet Factory Defaults Read Failed on Adpt=%d, Conc=%d, Port %d***** flash rom load ***** Set factory defaults to chan=%d rsp=%s Surpress Echo Write Failed To Adpt=%d, Conc=%d, Port %d, rtn=%dSurpress Echo Read Failed on Adpt=%d, Conc=%d, Port %dSet Surpress Echo Bad Response on Adpt=%d, Conc=%d, Port %d***** flash rom load ***** Bad rsp to surpress echo cmd=%s ***** flash rom load ***** Surpress echo to chan=%d rsp=%s Get Modem Version Write Failed To Adpt=%d, Conc=%d, Port %d, rtn=%dGet Modem Version Read Failed on Adpt=%d, Conc=%d, Port %dGet Modem Version Timeout on Adpt=%d, Conc=%d, Port %d***** flash rom load ***** Timeout on get modem version cmd=%s ***** flash rom load ***** Get modem version to chan=%d rsp=%s I34A20381633%s invalid for 1633 Modem on Adpt=%d, Conc=%d, Port %d***** flash rom load ***** File '%s' not valid for 1633 chipset 00.00IC020691634ac%s invalid for 1634AC Modem on Adpt=%d, Conc=%d, Port %d***** flash rom load ***** File '%s' not valid for 1634 AC chipset 00.00IE020691634ae%s invalid for 1634AE Modem on Adpt=%d, Conc=%d, Port %d***** flash rom load ***** File '%s' not valid for 1634 AE chipset 00.00Unidentifiable modem on Adpt=%d, Conc=%d, Port %d***** flash rom load ***** Unidentified chipset Flash ROM Load for Adpt=%d, Conc=%d, Port=%d, cancelled Send Loader Write Failed To Adpt=%d, Conc=%d, Port %d, rtn=%dSend Loader Read Failed on Adpt=%d, Conc=%d, Port %dSend Loader Bad Response on Adpt=%d, Conc=%d, Port %d***** flash rom load ***** Bad rsp to send loader cmd=%s ***** flash rom load ***** Send loader to chan=%d rsp=%s Start Loader Cmd Write Failed To Adpt=%d, Conc=%d, Port %d, rtn=%dStart Loader Cmd Read Failed on Adpt=%d, Conc=%d, Port %dStart Loader Cmd Bad Response on Adpt=%d, Conc=%d, Port %d***** flash rom load ***** Bad rsp to start loader cmd=%s ***** flash rom load ***** Start loader to chan=%d rsp=%s Erase Flash ROM Write Failed To Adpt=%d, Conc=%d, Port %d, rtn=%dErase Flash ROM Read Failed on Adpt=%d, Conc=%d, Port %dErase Flash ROM Timeout on Adpt=%d, Conc=%d, Port %d***** flash rom load ***** Timeout to erase ROM cmd=%s Erase Flash ROM Bad Response on Adpt=%d, Conc=%d, Port %d***** flash rom load ***** Bad rsp to erase ROM cmd=%s ***** flash rom load ***** Erase ROM to chan=%d rsp=%s Send Flash ROM Write Failed To Adpt=%d, Conc=%d, Port %d, rtn=%d***** flash rom load ***** Short block, should timeout Send Flash ROM Read Failed on Adpt=%d, Conc=%d, Port %d***** flash rom load ***** Send flash ROM to chan=%d rsp=%s Reset Loader Cmd Write Failed To Adpt=%d, Conc=%d, Port %d, rtn=%dReset Loader Cmd Read Failed on Adpt=%d, Conc=%d, Port %dReset Loader Cmd Bad Response on Adpt=%d, Conc=%d, Port %d***** flash rom load ***** Bad rsp to reset loader cmd=%s ***** flash rom load ***** Reset loader to chan=%d rsp=%s Startup Cmd Write Failed To Adpt=%d, Conc=%d, Port %d, rtn=%dSecond open failed for Adpt=%d, Conc=%d, Port=%dSet New Factory Defaults Write Failed To Adpt=%d, Conc=%d, Port %d, rtn=%dFlash ROM Load Successful on Adpt=%d, Conc=%d, Port %d%s ***** get_em_device ***** slot=%d, calc_slot=%d, conc=%d, port=%d, calc port=%d rawk '/epca / { print $NF }' /etc/name_to_major***** get_em_device ***** Couldn't do popen() searching for driver name in /etc/name_to_major %d***** get_em_device ***** Couldn't do fscanf() ***** get_em_device ***** makedev() failed, errno=%d Calculated major=%d & minor=%d Device name='%s' ***** get_em_device ***** mknod() failed, errno=%d Calculated major=%d & minor=%d Device name='%s' ***** get_em_device ***** mknod() done Calculated major=%d & minor=%d Device name='%s' 00%2d.%4d%2d.%4d00.00cd %s 2>/dev/null;ls *.flrom 2>/dev/nullr%s%s%srInvalidInvalidInvalid0D0A0D0A%4x2E%4x%c%c.%c%c%4x2E%6x%c%c.%c%c%c%4x2E%8x%c%c.%c%c%c%cInvalid00000001Invalid***** get_flr ***** flashrom_c=%d file %d =%s, Rev=%s ACACC/XEPC/X0=8( Digi Port Authority version %sCopyright (c) 1998, Digi International Inc./tmp/dpalogYou must be a super-user to execute %s! f:l:dm?rw/tmp/dpadebugf:l:dm?ransi,:;sco_colors!sco_colorsatt_colors!att_colorsrev_colors!rev_colorsbw!bwul!ul,:;Couldn't allocate color pair ,Yv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfvYZ    p oo X oWpYpY $04( ,8<!%15 ) -9=$Id: dpa.c,v 2.99 1998/08/01 13:04:19 steveb Exp $@(#)dpa_fep.h 1.2 9/9/97@(#)dpa.h 1.30 7/8/98\[[[[DOWN\-/|@i ihhhh0hgggPggffpf8ffeeXe eddxd@ddcccctchc\cPcc cbbdb,baaaLaaa```````````x`l```T` `___P__^^|^D^ ^]]d]0]Speed = 10M, 8-wire internal clock, Direct ConnectSpeed = 7.373M, 8-wire internal clock, Direct ConnectSpeed = 3.686M, 8-wire internal clock, Direct ConnectSpeed = 2.458M, 8-wire internal clock, Direct ConnectSpeed = 1.843M, 8-wire internal clock, Direct ConnectSpeed = 1.843M, 4-wire self clocked, Direct ConnectSpeed = 1.843M, 4-wire self clocked, Direct ConnectSpeed = 921K, 4-wire self clocked, Direct ConnectSpeed = 921K, 4-wire self clocked, Direct ConnectSpeed = 460K, 4-wire self clocked, Direct ConnectSpeed = 460K, 4-wire self clocked, Direct ConnectSpeed = 230K, 4-wire self clocked, Direct ConnectSpeed = 230K, 4-wire self clocked, Direct ConnectSpeed = 115K, 4-wire self clocked, Direct ConnectSpeed = 115K, 4-wire self clocked, Direct ConnectReservedReservedReservedReservedReservedReservedReservedReservedReservedReservedReservedReservedReservedReservedReservedReservedSpeed = 76.8K, 8-wire ext clock RS-232, Sync ConnectSpeed = 64K, 8-wire ext clock RS-232, Sync ConnectSpeed = 57.6K, 8-wire ext clock RS-232, Sync ConnectSpeed = 38.4K, 8-wire ext clock RS-232, Sync ConnectSpeed = 19.2K, 8-wire ext clock RS-232, Sync ConnectSpeed = 14.4K, 8-wire ext clock RS-232, Sync ConnectSpeed = 9600, 8-wire ext clock RS-232, Sync ConnectSpeed = 4800, 8-wire ext clock RS-232, Sync ConnectSpeed = 2400, 8-wire ext clock RS-232, Sync ConnectReservedSpeed = 14.4K, 8-wire ext clock RS-422, Sync ConnectReservedReservedReservedReservedReservedReservedSpeed = 1.2M, 8-wire ext clock RS-422, Sync ConnectSpeed = 920K, 8-wire ext clock RS-422, Sync ConnectSpeed = 460K, 8-wire ext clock RS-422, Sync ConnectSpeed = 230K, 8-wire ext clock RS-422, Sync ConnectSpeed = 115K, 8-wire ext clock RS-422, Sync ConnectSpeed = 76.8K, 8-wire ext clock RS-422, Sync ConnectSpeed = 57.6K, 8-wire ext clock RS-422, Sync ConnectSpeed = 38.4K, 8-wire ext clock RS-422, Sync ConnectSpeed = 19.2K, 8-wire ext clock RS-422, Sync ConnectSpeed = 9600, 8-wire ext clock RS-422, Sync ConnectSpeed = 4800, 8-wire ext clock RS-422, Sync ConnectSpeed = 2400, 8-wire ext clock RS-422, Sync ConnectSpeed = 1.2M, 8-wire internal clock, Direct ConnectSpeed = 920K, 8-wire internal clock, Direct ConnectSpeed = 460K, 8-wire internal clock, Direct ConnectSpeed = 230K, 8-wire internal clock, Direct ConnectSpeed = 115K, 8-wire internal clock, Direct ConnectSpeed = 76.8K, 8-wire internal clock, Direct ConnectSpeed = 57.6K, 8-wire internal clock, Direct ConnectSpeed = 38.4K, 8-wire internal clock, Direct ConnectSpeed = 19.2K, 8-wire internal clock, Direct ConnectSpeed = 9600, 8-wire internal clock, Direct ConnectSpeed = 4800, 8-wire internal clock, Direct ConnectSpeed = 2400, 8-wire internal clock, Direct ConnectSpeed = 460K, 4-wire self clocked, Direct ConnectSpeed = 230K, 4-wire self clocked, Direct ConnectSpeed = 115K, 8-wire internal clock, Direct Connectidpaidpa_info1idpa_info2idpa_info3idpa_info4idpa_info5idpa_info6idpa_info7idpa_info8 jdpa_info9j Digi Port Authority 8j2Dj92(PjXr $Revision: 2.99 $lj/etc/digi/text/info/j/etc/digi/em_modem/jem_resultflashrom.loaderkkkkkk|kpkdkXkLk@k4k(kkk: 38.4 K Baud: 19.2 K Baud: 9600 Baud: 4800 Baud: 2400 Baud: 1800 Baud: 1200 Baud: 600 Baud: 300 Baud: 200 Baud: 150 Baud: 134 Baud: 110 Baud: 75 Baud: 50 Baud: 0 Bauduuuuuuuuutuhu\uPuDu4u$uuuttttttttxthtXtLt- pp?< ?E ? N``BSH`MYpp'_*eĕd1m(G(vW|{,Y,YY ZL5@@H195 n!07070100060e1f000081a400000002000000020000000136434eaa0000011c000000ad0000000400000000000000000000001700000004root/tmp/pcxx/dpa_infoIt seems that you have an old version of Digi Port Authority (DPA) in your system. MPI only supports DPA version 2.0.0 or later. Please reinstall the MPI software package, or you can download the latest DPA from Digi's BBS system, then copy it to /usr/bin/dpa. 07070100060e20000081a400000002000000020000000136434eaa0000097b000000ad0000000400000000000000000000001800000004root/tmp/pcxx/dpa_info1The fields in the DPA main screen have the following meanings: Type: The bus type (EISA, ISA, MC) and board type (C/X, Xem, EPC/X, Xr, Xi, SmartPort) detected by the Digi device driver. State: The current state of the board. Possible values are: OK Indicates the adapter is functioning normally. NOT FOUND The device driver could not identify this type of board. NO IO The device driver was unable to communicate with the board via the I/O port. Switch settings could be incorrect. NO MEMORY The device driver was unable to allocate the necessary memory for this board. NO BIOS Unable to download the BIOS image. Possible hardware failure. NO FEP/OS Unable to download the FEP/OS image. Possible hardware failure. H/W FAIL An unrecoverable error with the FEP/OS has been detected. Possible hardware failure. NO PORTS (Xem system only) The BIOS on the Xem host adapter could not detect any ports. Possible hardware failure or there is no port module attached to the adapter. I/O Addr: The adapter's I/O port address (hexadecimal). Mem Addr: The starting address of the adapter's dual ported memory (hexadecimal). Mem Size: The size of the adapter's dual ported memory. #Ports: The number of ports for which the device driver has been configured (this may be different than the actual number of ports physically attached). To get more information about one of the displayed adapters, use the up and down arrow keys to move the highlighted bar to the desired board, then press . NOTE: If the arrow keys do not map correctly, the DPA program will display the following message: Invalid Key. If this occurs, substitute the standard UNIX cursor movement keys for the up and down arrows: Down = J or j; Up = K or k; Left = H or h; Right = L or l. The Print Screen (^P) option invokes a screen dump to the default file /tmp/dpalog. If another file and/or path is desired, simply invoke dpa with the -l option. e.g. dpa -l 07070100060e21000081a400000002000000020000000136434eaa0000033c000000ad0000000400000000000000000000001800000004root/tmp/pcxx/dpa_info2The current display shows the status of the selected host adapter. Concentrators are represented by: [AC] if active [DN] if inactive (turned off, defective, or otherwise down) The display also shows the speed and wiring method between the host adapter and the first concentrator (node), and between subsequent interconnected concentrators. To see a C/X or EPC/X host adapter's configuration string, use the arrow keys (or H, J, K and L keys, if your arrow keys aren't correctly mapped) to highlight either Adapter Line box, and press . The Print Screen (^P) option invokes a screen dump to the default file /tmp/dpalog. If another file and/or path is desired, simply invoke dpa with the -l option. e.g. dpa -l 07070100060e22000081a400000002000000020000000136434eaa00000222000000ad0000000400000000000000000000001800000004root/tmp/pcxx/dpa_info3The configuration string shown is what the FEP/OS has stored in memory during system configuration. The FEP/OS uses this string to determine line speeds and connection types between the host adapter and concentrators, and between interconnected concentrators. This is useful for diagnosing configuration problems. The Print Screen (^P) option invokes a screen dump to the default file /tmp/dpalog. If another file and/or path is desired, simply invoke dpa with the -l option. e.g. dpa -l 07070100060e23000081a400000002000000020000000136434eaa00000fd3000000ad0000000400000000000000000000001800000004root/tmp/pcxx/dpa_info4This graphic simulation of the concentrator's front panel is dynamically updated at half second intervals, and shows the current status of the channel selected. Activity on the synchronous channel is indicated by the rotating "helicopters" after the terms "Sync Packets TxD:" and "Sync Packets RxD:" in the upper right-hand corner of the screen. The inner box shows the state of the RS-232 signals TxD, RxD, RTS, CTS, DSR, DCD, DTR, RI, and input and output flow control states (OFC and IFC). An inactive signal is indicated by a dash (-) under its name. An active signal is indicated by a block under its name. If data is currently being transmitted or received, a blinking "X" will appear under the signal name (TxD or RxD, respectively). The status of the concentrator appears at the far right of the inner box; DN if the communication to the host adapter is down. (AC, 16em, 8em, or 8emp) if the connection to the host adapter is good. Input Modes *Not a standard UNIX flag IGNBRK Ignore Break BRKINT Interrupt on Break IGNPAR Ignore parity errors PARMRK Mark parity errors INPCK Input parity check ISTRIP Strip input characters ITOSS* Toss IXANY characters IXON Enable start/stop output IXANY Restart output on any character IXOFF Enable start/stop input IXONA* Enable start/stop output Auxiliary Output Modes *Not a standard UNIX flag XCASE* Canonical upper/lower display OLCUC Map lower case to upper ONCLR Map NL to CR/NL OCRNL Map CR to NL ONOCR No CR output at column 0 ONLRET NL performs CR function OFILL Use fill characters for delay OFDEL Fill character is DEL; otherwise NUL NLDLY NL delay is selected CR1 Carriage Return delay type 1 CR2 Carriage Return delay type 2 CR3 Carriage Return delay type 3 TAB1 Tab delay type 1 TAB2 Tab delay type 2 TAB3 Tab delay type 3 BS1 Backspace delay VT1 Vertical tab delay FF1 Form feed delay Control Modes Baud Rate 50, 75, 110, 134, 150, 200, 300, 600, 1200, 1800, 2400, 4800, 9600, 19200, 38400. If Fast Baud is set baud rates of 50, 75, and 110 are translated to 57600, 75600, and 115200, respectively. For parallel ports, the baud rate defines the pulse width of the data strobe. Char Bits 5,6,7,8, or None. Stop Bits 2,1, or None. Parity Enabled, Odd, or None. Fast Baud* Use fast baud rates. *Not a standard UNIX flag LoopBack Test: A loopback plug must be installed in the channel to be tested. A loopback diagnostic test can be run against any selected channel by pressing the T (or t) key from the channel monitoring screen. The loopback plug specification: The loopback plug for RJ-45 versions (Digi Intl. Part Number 60000401) consists of a single 10-pin RJ-45 plug wired as follows: Pin 3 connected to pin 1 and 8 (RTS to RI and CTS); Pin 5 connected to pin 6 (TxD to RxD); Pin 9 connected to pin 2 and 10 (DTR to DSR and DCD). For DB-25 versions (Digi Intl. Part Number 60000442), the loopback plug consists of a female DB-25 connector wired as follows: Pin 4 connected to pin 22 and 5 (RTS to RI and CTS); Pin 2 connected to pin 3 (TxD to RxD); Pin 20 connected to pin 6 and 8 (DTR to DSR and DCD). Note: The port must be disabled prior to running the loopback test. The Print Screen (^P) option invokes a screen dump to the default file /tmp/dpalog. If another file and/or path is desired, simply invoke dpa with the -l option. e.g. dpa -l 07070100060e24000081a400000002000000020000000136434eaa00000b1b000000ad0000000400000000000000000000001800000004root/tmp/pcxx/dpa_info5This graphic simulation of the concentrator's front panel for the parallel port, (Channel 9) of a PORTS/8emp module, is dynamically updated at half second intervals, and shows the current status of the channel selected. IP1, IP2, and IP3 reflect the state of Input Ports 1-3 (usually ERROR, SELECT, and FAULT, respectively). OP reflects the state of Output Port 2 (usually SELECTIN). OFC or IFC reflect BUSY status (depending on output or input mode, respectively). An inactive signal is indicated by a dash (-) under its name. An active signal is indicated by a block under its name. If data is currently being transmitted or received, a blinking "X" will appear under the signal name (TxD or RxD, respectively). Input Modes *Not a standard UNIX flag IGNBRK Ignore Break BRKINT Interrupt on Break IGNPAR Ignore parity errors PARMRK Mark parity errors INPCK Input parity check ISTRIP Strip input characters ITOSS* Toss IXANY characters IXON Enable start/stop output IXANY Restart output on any character IXOFF Enable start/stop input IXONA* Enable start/stop output Auxiliary Output Modes *Not a standard UNIX flag XCASE* Canonical upper/lower display OLCUC Map lower case to upper ONCLR Map NL to CR/NL OCRNL Map CR to NL ONOCR No CR output at column 0 ONLRET NL performs CR function OFILL Use fill characters for delay OFDEL Fill character is DEL; otherwise NUL NLDLY NL delay is selected CR1 Carriage Return delay type 1 CR2 Carriage Return delay type 2 CR3 Carriage Return delay type 3 TAB1 Tab delay type 1 TAB2 Tab delay type 2 TAB3 Tab delay type 3 BS1 Backspace delay VT1 Vertical tab delay FF1 Form feed delay Control Modes Baud Rate 50, 75, 110, 134, 150, 200, 300, 600, 1200, 1800, 2400, 4800, 9600, 19200, 38400. If Fast Baud is set baud rates of 50, 75, and 110 are translated to 57600, 75600, and 115200, respectively. For parallel ports, the baud rate defines the pulse width of the data strobe. Char Bits 5,6,7,8, or None. Stop Bits 2,1, or None. Parity Enabled, Odd, or None. Fast Baud* Use fast baud rates. *Not a standard UNIX flag LoopBack Test: A loop back plug must be installed in the channel to be tested. (Digi Intl. part number 60000401 for RJ-45, or 60000442 for DB-25). The Print Screen (^P) option invokes a screen dump to the default file /tmp/dpalog. If another file and/or path is desired, simply invoke dpa with the -l option. e.g. dpa -l 07070100060e25000081a400000002000000020000000136434eaa000001ea000000ad0000000400000000000000000000001800000004root/tmp/pcxx/dpa_info6The current display shows the status of the selected Xem host adapter. Attached PORTS modules are each identified by one of the following: [16em] for PORTS/16em modules [8em] for PORTS/8em modules [8emp] for PORTS/8emp modules The Print Screen (^P) option invokes a screen dump to the default file /tmp/dpalog. If another file and/or path is desired, simply invoke dpa with the -l option. e.g. dpa -l 07070100060e26000081a400000002000000020000000136434eaa00001da1000000ad0000000400000000000000000000001800000004root/tmp/pcxx/dpa_info7 Host Status (C/X and EPC/X Systems Only) The DPA program provides several status and error counters to aid you in monitoring activity between the host adapter and concentrators, and diagnosing possible communication problems. Several of the counters increment steadily under normal conditions. An incrementing counter does not necessarily indicate a problem. For example, if a concentrator is turned off, several counters will increment. When the concentrator is turned back on, those counters will stop incrementing. If any counters that are usually idle begin to increment steadily, perform the recommended tests described for that counter. Call Digi Intl. Technical Support if the counters continue to increment steadily after performing the recommended tests. Activity Counters ----------------- RECEIVE1 The number of times the host adapter processed a request from a concentrator, and one packet was received. Under idle conditions, RECEIVE1 will increment, representing the "heartbeat" of the concentrators communicating with the host. RECEIVE2 through RECEIVE4 The number of times the host adapter processed a request from a concentrator, and two, three, or four packets were received. RECEIVE5 The host adapter is 100% busy if RECEIVE5 is incrementing. Users may experience slower response time. Monitor EC (Error Count) on the concentrator front panel. The Digi Intl. product in use is being maximized. Consider adding another host adapter, or advance to the EPC/X system if you are currently using the standard C/X product. TRANSMIT The number of data packets transmitted from the host. Under idle conditions, the TRANSMIT counter will increment. This is the "heartbeat" of the host checking the status of communications to the concentrators. Under normal operating conditions, the TRANSMIT counter will increment. Sync Counters ------------- *For diagnostic information see the concentrator Installation Guide. ERR_UFRAM The host adapter received an incomplete packet. Check the physical hardware configuration to ensure a stable environment. Check for other incrementing counters. ERR_ABSTAT The host adapter received a bad data packet, and discarded it. Check for concentrator "down" [DN] status. Check the physical hardware configuration. If the ERR_ABSTAT counter is constantly incrementing, run the concentrator diagnostics*. Call Digi Intl. Technical Support. ERR_INC The host adapter received an incomplete data packet. Check the physical hardware configuration. If this counter is constantly incrementing, call Digi Intl. Technical Support. ERR_CRC The host adapter received a packet with a CRC error. Run the concentrator sync line diagnostic tests*. If this counter is constantly incrementing, call Digi Intl. Technical Support. ERR_DATA The host adapter received a packet with an error found in the data. This will cause other counters to increment. Check sync line connections. Run the concentrator sync line diagnostic tests*. If this counter is constantly incrementing, call Digi Intl. Technical Support. ERR_NACK The host adapter received a negative acknowledgement from the concentrator for one of its messages. Check sync line connections. Run C/X host adapter diagnostics*. If this counter is constantly incrementing, call Digi Intl Technical Support. *For diagnostic information see the concentrator Installation Guide. Saturation Counters ------------------- ERR_TBUF The transmit buffers on the host adapter are full. The data is not getting out to the ports fast enough. Also monitor RECEIVE1 through RECEIVE5 and TRANSMIT counters. ERR_FIFO The host adapter is receiving more data than it can handle. Also monitor RECEIVE5. ERR_ORUN The host adapter is receiving too much data; the host adapter is 100% busy. The Digi Intl. product in use is being maximized. Consider adding another host adapter, or advance to the EPC/X system if you are currently using the standard C/X product. ERR_TBUSY The number of times the host adapter tried to transmit data when the transmitter was busy. Also monitor RECEIVE counters. ERR_RITEM The receive buffer on the host adapter is full; the host adapter is 100% busy. Also monitor the ERR_ORUN counter. FEP Counters ------------ ERR_REC0 The number of times the host adapter received a request from a concentrator, but no packets were received. If the environment is stable and no other counters are incrementing call Digi Intl. Technical Support. ERR_ADDR The host adapter received a message that contains an invalid node number. This is not a physical node number error, but a software node number error. If this counter is constantly incrementing, call Digi Intl. Technical Support. ERR_MTYPE The host adapter received a message with a bad message type. If this counter is constantly incrementing, call Digi Intl. Technical Support. ERR_MSIZE The host adapter received a message with a bad length. If this counter is constantly incrementing, call Digi Intl. Technical Support. ERR_RID The host adapter received a message with an out-of-sequence message ID. This is not a physical node number error, but a software node number error. If this counter is constantly incrementing, call Digi Intl. Technical Support. ERR_TID The host adapter sync line transmit sequence number is out of sequence. If this counter is constantly incrementing, call Digi Intl. Technical Support. ERR_PING The host adapter received a sync line ping message when not in ping mode. If this counter is constantly incrementing, call Digi Intl. Technical Support. Hardware Counters ----------------- ERR_ABREC The host adapter aborted receiving a packet. Run C/X host adapter diagnostics. If a hardware problem is detected, try a different host adapter. ERR_URUN The host adapter transmitted an incomplete packet. Run C/X host adapter diagnostics. If a hardware problem is detected, try a different host adapter. ERR_CONC (counter increments for C/X Systems Only) A message sent to the concentrators was sent back to the host adapter. A concentrator is down. Back up one screen in DPA to check for "DN" status on a concentrator. Check the power on the concentrator and reset the concentrator. If the counter is still incrementing, try a different concentrator. ERR_CHECK The host adapter received an incomplete status packet. Run concentrator diagnostics. If a hardware problem is detected, try a different concentrator. The Print Screen (^P) option invokes a screen dump to the default file /tmp/dpalog. If another file and/or path is desired, simply invoke dpa with the -l option. e.g. dpa -l 07070100060e27000081ff000000000000000000000001364c8ed90001b6ac000000ad0000000400000000000000000000001300000004root/tmp/pcxx/pcxxELF|4( U WVSu] }tQ2èt]jVSWuSufQuMSutCESuGN]t2èt1jPSWEEP΀Mˋ$<{ltSuf|#jPSWu$|Suf%[^_UWVSu] }t92ètFjVWSufPWu PWu tGECPWu N}t2èt1jPWSEEP΀$<uw PWutfPWu |#jPWSu$|fPWu ![^_UVthjjhh #t"VhVh<j h#jjhX hjjhd hjjhp hjjh| hh+ɺIA|h/^ÐUWVthTjh#u htVhdj =WW5hhh<$^_ÐUthjuhÐUWVutVhj thj+^_ÐUWVSthj5V]SS th WPhjV+[^_ÐUWVutVu hjV% uu3Phj s QPh<jZE #uEQ5#t++ +ɡt#t 뢐=uϐ^_ÐUWVSEEu tVhhj hEE#t#uVh hjh hjuh h(ju5 y5h juj#uFuEutVuhjhV#u+"u5=u5#EEG@G4G8tuuhXjtjhxj 5 DžhhPEPVjjujddtVuh h jE#t5 DžhhPhVjjujddPVuh$ hj=hVuhp hjG#t#~ VPGEǁP5ht"uhj hE[^_ÐH54 DžhhPGDPVjjujddt"wDVuhH hj*DžhhPGxPhX jjujddtGxGD4pjVG#u%hNuhh hTjGD@EjPG<#GtwDwuhjDžhhPG0Ph jjujddtuh hjG0hP`Ph jjujddt7uh hDjkP`Tjht` #fGNffGN+ fGN@f@h#~Q`fGN fGNW= <EA; ~ EGDtuhpj =u =jh|` #!jh` #`uh hjh#G<#t}~ uPG< UWVStu hj SE#t } Ph huh hjSPǃ~lF PFPF\PF^P`Vuuu5thHj+[^_ÐPEtuhj u5#=~#=SW=FEPES^#tv++ɋFD;sM{t6CPC PC|PPFDG ;r^ȍ HQSF+N<#tFD@PQ~<#tND;v +=P=+N@@9@=|U@=2u uh\j+ÐUM+P$+UWVS]s\=t3P5GE#uh h X}u+[^_ÐGP} uVh hlj+;wDs҉}]{Wƃ$CXf%f=u s`f%f=uWC PF };wDrQUWVShut#EPEPu v\hjFxP^SSh h f@pP$PFf@pPFfxr ujf@p@PFplh h jV FE}Su#}U+[^_ÐFplNfApfyr u h@jPE PFfEfEFf}fMM QUfMɍ Q F\%PMfEPF EEEEfEPMfEPF fEff%fEfEPE PF E PFfEFf@pP$PFf@pPFfxr ujf@p@PFplfEEEPjE%E%EfEjPE PFfEE PFfEFf@pP$PFf@pPFfxr ujf@p@PFplfEfMf+%E9]\EPjE%EMfU;t 8MfMɉM}} ;EsE+E%=@r1FplNfApfyr h@t5uh` hjjV^h0 hf UWVShutfEPu v\hjFxP^SShD h if@pP$PFf@pPFfxr ujf@p@PFplhX h jVJ FE}Su"}U+[^_FplNfApfyr u h@jPE PFfEFf}fMM QUfMɍ Q F\%PMfEPF fEPMfEPF fEff%fEfEPE PF E PFfEFf@pP$PFf@pPFfxr ujf@p@PFplfEEEPjE%EfEjPE PFfEE PFfEFf@pP$PFf@pPFfxr ujf@p@PFplfEfMf+%E9]rEPjE%EMfU;t 8MfMɉM}};Es@+E%=@r/FplNfApfyr h@t5uh hjjVhl h UWVSjj(#G+ۋG@ O A(Gjj$#tuGO A $p N$HjFPF<F^ !Et u!H`#t$WQ"WPW #u[^_U$WVSu~tWVv\h jFEP$ |"tv\h0j ^`#tTjSjv`$ujhS hSu#tWjSj$ujhS hSuFXftf%FXF`#tP$ft%f%#tP$&FplNfApfyr u h@jPjGYPF GPFP_SF SFf WFFf@pP$PFf@pPFfxr ujf@p@PFpluj WhVj jhVEKfutWv\hjj PhVEu<ff;tJtWv\hjfuj ShV2u#ft uffF(ff;tWv\hjff3Áfu#t"tWv\hjVj PhVmufF(+ۨt@tˀt t t ًt"ft t tˀt يM:t] t RPEPPv\h, juj hShVu2]"2]3 tW2èu  u u  Àu PQv\hp juj hSWV=uE:u:t~t*PEPv\h jEEFp^quj SuhVu:t8^wuj jShVZuuth j+[^_Ð"thPjfF(E$Etff$EtfFf@Nf8=t: t2߁]IMπ}< Etff $<πf u"}u}t f fsfڨtPv\hdjuj ShVuff;uUfEf=`f=X      4 L xd p h ` X P H@(8@0P(` f=Ptff=w $ pf=w.4f=Bf=df=tf=Đf=2f=Df= jf=#@또U`WVSEEfEEEuEtv@hP j jjhF EPjjhFEPjjhFEPjjhF\EPjjhF^EPjjhF`EPF|EPEPhjuj#uiF| @E|uP~H+ۍ<[=u!jjhPF@;F@C|hp jhh j nhht j FPPfFpPhh jFP*Ph h jFP fFpPfFNPPh@ht jFPFljhjujfFpf#$FQEjPj+fFpP$<t-jGfFpP$<uӿfFpPfNpɨQ%0 Mԋ =~=#%ffFrINhqFhfFrfNNES% PfFpPFHPfFpPfFr FhNHdjQfFpPfNNafNNEHFhfFrfFpP$NH<@D#PEPjjjjEPv|u$fFp}jP+fFpP$<t-jCfFpP$<ufFpP$fNp<@u hAQQ PfFpPhfFpPhhh fFpPhph f}* ~fEf}5M̉MԋEȉEfNr}f t fFpP$fNp<@u hAQQ PfFpP+;}$ύyPQ C;|fFpP$fNp<@u hAQQ PfFpPfFN$ft<jE@ P fEfPEB P jED P WEF P jEH P PEJ P j fFpPjfFpP+ۋE@ P#t2LjYCE@ P#ufFpP$fNp<@u hAQQ PfFpPjE P jE@ P WEB P jED P jfFpPjfFpPfFpP$fNp<@u hAQQ PfFpP+E P ;t9djGE P ;ufFpP$PfFpPfFpP$<@ujfFp@PfFN$<u"}thEP EF fFpP$fNp<@u hAQQ PfFpPE" PfFpP$PfFpPfFpP$<@ujfFp@PFD;tzPWhh jNDAPvFD@Pv<~DjPF#tNuhj :uWVuhjuhu^F t Wuut5vhj+[^_+ PF^#uh=~'Sh=ߍOMQOM#tpPVuhjN GplOfApfyr u h@jPjEVPG Gf@pP$PGf@pPGfxr ujf@p@PGplN#t.tvh$j NQFFFtOtH tPhPj uG1PG:PW u'uthj+ɡ;}"94uHA;|+ۡ;uM9Eht$hIpShjhhuuhC;JuhuF OX tvhj E MGi@x@BP؁?r?EPj]]GplOfApfyr u h@jPM MQGEGf@pP$PGf@pPGfxr ujf@p@PGplM M M̉MMȉMvhDj EEȋMM̉uuȋẺE؋EE܋EEGplOfApfyr uh@jPuGEu܋GEEO;EEKPȋGf@p#MMM܉MM؉MuuP$PGf@pPGfxr ujf@p@PGplMMM܉MM؉Muuzvhj bfApP$PGf@pPGfxr ujf@p@PGplGxxEPjE%EM;M]0Gi@x@BPEԁ}?rE?EPjEE%EEE ff"u f#]0f#tCffVj fPhWV"t9Vj hjhWVƇfLJGi@x@BPEЁ}?rE?EPjEE%E+%=@]0h$SP VS#MMM܉MM؉Muu$Ms;뉐MMM܉MM؉M̉uȋuN0Mċ]̃LplOfApfyr uh@jPjSG Gf@pP$PGf@pPGfxr ujf@p@PGpluuȡ$#t"m>M̉MMȉM"tvh uGEuGء$tNEKPGPPEPvhpjM M$"tvhj ft:ffuj ShWut=ƇfLJuj hjhWuGplOfApfyr uh@jPuGEGf@pP$PGf@pPGfxr ujf@p@PGpluj EPhWj jhWиuЀf%pfO(ttff;t;ffuj ShWfuƇuj hjhW{h EEPjEEGTt WuUWVS} tuwhj] C 7{@ K UQSR Q A+AU@ Q A@ PAP UPC@ tA@ p0whDjC#t Ps+[^_ÐjUUR#_V_V<$hjuGU\WVSEEM#uhu Qqh|jEuuMQqhjWWu +[^_Ð{WMA#tPE}tCE#tE EH Mt/1Mqhj MA#tPMAWM=d=T=k "tRMqhjE<EMq &MA EjPE@@ PE"PC Cf@pP$PCf@pPCfxr ujf@p@PCpl<$w:=A XEpWF WEEF FEMA fAjE PEP WEEF FEMA EptE@@ 8{WMQt CXEM =M$E@p tQRhjE%oEFuE=ȁMܩ u"E]EKKfANf%8HEfApPȀ@uUM܍ uȁ}t(fU Uܨ` щ MF Ft$ǃǃEԊFNf;u Ef;tW$WFFFjChPV jSff% ǃEЊ@ EЊ@ jChPuЃ V jPV MA }cCplKfApfyr uh@jPEf@fEEPCPEPC jEYPC jENPC Cf@pP$PCf@pPCfxr ujf@p@PCplfEfjuWjhu$ WtMqhlj W$ش<$WMt-RhjMjTptRMqhjMA =jhjTjhiTjhtjhtuuE} E@@ EСtQRhDjfEf fEf@ ʉ%uE=ftgKfANf%8HEfApP$<@u #t+M9t@=|틋` 񉳼fEf@ Ef@f ǃ=)E@@ 0tVMqhjuW#WWth@jSWCHlC)uQKfApfyr u h@jPjEVPC /jPPEVPC #ߋETPCEȋCf@pP$PCf@pPCfxr ujf@p@PCplMu tuC P PmjPEPCPuVC VCfjEYPC Cf@pP$PCf@pPCfxr ujf@p@PCplju$Wjhu$ WXW FW#4tMqh@j E@p WfffFffFffFfQKfApfyr Vh@M$s`#t$WhVWKY#t'WhVWCXf%f=uC`#t Pf%f=u#Wy tMqh`j Ep#t%NA+A=sVE@+#8jj#+tRMqhjE@@ 8={t+tM1Mqhjj Cf@PhSӧ=ztu+Mqhj tMQqhjEp#t%NA+A=sVE@+#;jj#WEMAWuhjjWEMAWuhjj$WEMAWuhjjWEMAWuhjjVWEMAWuhjj*WEMAWuhjj MAEpN MWMf=tf%fAfff fQfAMfA# tMQqhjEp#t%NA+A=$sVE@+#ujj$#4EpN MWMAA #t AjEPEP WE$tMqh@j E@p =t =@juW#CplKfApfyr u h@jPE PCfECf@pP$PCf@pPCfxr ujf@p@PCpl<$j fEPhS螣j jhS茣WCXftf%CXuftf%uW=t#WMA>CplKfApfyr h@$X E@p tVMqh\j#umW Wj jhW#Wj jhSh@$軧+=t== M"tMqhj Ep#t%NA+A=$sVE@+#ujj$#EpWVW~ s( _^WE$y +"tMqhj My $2WE@VW{(p fc(fC*f= _^s fC* f f9C.sfC.fK,fs fC,ff;vfC,{0vC0{1vC1C)tƃƃƃƃWhjy tMqhj Ep#t%NA+A=sVE@+#ujj#EpWCplKfApfyr uh@jPCTPCECf@pP$PCf@pPCfxr ujf@p@PCpl<$EtEtE t EtEt@E@tɀF =te=tZ=tt=tt =tMI t&E@@ 0MqhjMI +EE@@ tEtMWM=tuAƃE=E,EE"Ȉ=tt=ttWQSSy 5 tMqh8j Exjj#EP B@@ B B+JA XJ B@ HJA AE@@ pB@ p0MqhTB@ p0Mqhj0PEp'tuM1MqhjE@@ EMAtMqhj EHM#t,IA+A=suE@E}u"jjE}\MEH+Mq ffFfFE}}MfDNE}|Wft ft f t ftWEEMA A"tMqhj My  tMqhj Ex2jj#VEP B@@ B B+JA XJ B@ HJA AE@@ E@#uuzE@p Wffǃ+ftfǃfft ɀfft fftf ff;WtMqh j Ep#t%NA+A=sVE@+#ujj#EpF EWfEfffHffHffHWEVtMqh`j Ep#t%NA+A=sVE@+#ujj#EpWCplKfApfyr u h@jPE"PCȋF Cf@pP$PCf@pPCfxr ujf@p@PCpl =d=dA=d=dtMqhj My E@H f#|f=~dWCplKfApfyr h@=t=d7]tMqhj Ep#t%NA+A= sVE@+#ujj #EpF EWC@LȋECf@pȋEHCHHEHCHhAEH @CfHNEfHCHDEfHCHPEHWE h=X9=gTL=hT-=iTr=jT =X=X=Xv=d=dv}E@@ UWVS}t7whjt`G7#u7G#tLPG:GV$WV_#uV+[^_ÐU8WVSE}tEHM#t9#u/!F E @@ u u+[^_ÐGEPGEuE p ~  thjF#t PE @#t Pu |"tMqhj FP BEE H#t%QB+B=sQE @+#jj#unuE MAuuhjj,uE MAuuhjjMAE HY CAffCfC+W{f_uft ft f t ft u t,fCPfCPfPMqhjE @@ FEF FF@ FH EA tMqh4j E @X uffLJ+ftfLJfft fft ɀfftf ff;ut<$L  tfG(PMqhTjF#tPFE @#tPE @FFF %PE X  Èu<$舖F+#t P~E @#tPE x~~~  thjE @+#tPE xv~~~ EV =X""tSh@j E'=jTuɋE @@ EtuMqhj+ۃ}u:uuu^}tF^ ^"thjWuGHlG)u=QOfApfyr u h@jPjEVPG  /jPPEVPG 'ߋETPGEGf@pP$PGf@pPGfxr ujf@p@PGplMu tdtuG P PQOfApfyr h@$G`E#t*uhuuOYE#t-uhuuGXf%f=uG`#t Pf%f=u#uF#t P^E @#}-FE @@ ( ='=iT tMqhj FP BE؋E X#t%KA+A=sSE @+#ujj#E XC CuC uE @@ FE؉F FF@ FH E؉A# =t~"tMqhj FP BEԋE H#t%QB+B=sQE @+#ujj#E HY CAuGplOfApfyr u h@jPETPGEЋGf@pP$PGf@pPGfxr ujf@p@PGpluȀ EЀtȀ Et E t Et Et@ E@tɀ G)t@ E @@ FEԉF FF@ FH EԉA.FP =Xu=tt=tt =t+ۋE @@ ttu=tuƇy=tY=tb È"È?UWVS}u\PV@"tRshjWSztuhj +[^_ËEX#tS3#tMFEPuu*FPNAyPPu F@ <ukN 9Tu(E@<#t@@t+҉Q F PF@ 'AF@ ju$Vu&<F tjuF F uVtVuhdj} GP <y "G+G Psh Rshjmshj Rtshj uuj jh:tshj u&uj jhVنPshPjtshjuutsh0j jPV tE@<#@@tx"tRshjw +ɉN G HG@ 8}tQshjSSWu"&w =X2t=Tt=Tt=T;=Tt=Tt(=Xt=dt=dt=ztt={tt tG 0sh8jWuG tsh`j juG uNX"&&FplNfApfyr u h@jPF PFEFf@pP$PFf@pPFfxr ujf@p@PFpluj EPhVj jhVσuFXftf%FXuftf%uuG tsh|j uCF`#t jPFplNfApfyr u h@jPFPFPFPF FPFfjFYPF Ff@pP$PFf@pPFfxr ujf@p@PFpluQtshuK u<$utshXj u&utsh|j j)"tshj G 8"tshj jj$E}NG EG@ EjPE@<@@ !t u E!EH $HEH<$E#QAH=:}tPRshjS}"tn <<<<j<:"t/K#tPQhxjQhj #W<< < -<됐UWVS}tEHM#t #uhj 2%uMquhjNtRMqh| ju$"tMqh#j +[^_ÐCEPCE#cuGC#uMquh( JPKAyPPtM1QuqhP juMQ fyuEEEEEEEEuuPEԉE}EE}ءtvh("j j Cf@PhS}WEEEEEEKjPuCPWC WCfCf@pP$PCf@pPCfxr ujf@p@PCpluju$jhu$ tvhL!j j EPhSd|j jhSR|tvhx!j uVEE}, tPvht"jutv vh jWFt CXWEuE؃}@@ "<< b <M}EEE؉E̋E Eȋ}ԃ uCplKfApfyr uh@jPuȋCEWCEEK;EDEKPKfIp#3Q$PCf@pPCfxr ujf@p@PCpluE̋@ =TkEE}ԃu#CplKfApfyr h@}uMI WEԉE}uuMAu E EЋCplKfApfyr uh@jPVCEuЋCEE;EMI jELPC Cf@pP$PCf@pPCfxr ujf@p@PCpls:Cf@pP$PCf@pPCfxr ujf@p@PCpltMqh j uC1PVS膟 u#Ma tk$ @EPjh@ E%u5V AÀVu$~Mq qh!jPKEĀtjCLP KEtjCMP KfApP$PCf@pPCfxr ujf@p@PCplufMA f5WWEPjh}tWMq5h"jVMyt5@ǂ Vuu$Mq qh"juEEẺEfApuEEẺEQ$PCf@pPCfxr ujf@p@PCpltMqh$!j uEĀCP2=T=X=dt1EԉE}uEEu؋E܉EE E} EEEuCplKfApfyr uh@jPWCECf@pP$PCf@pPCfxr ujf@p@PCpluEEEEEE3;Fthh'|mE0FEv#F+F EuCplKfApfyr u h@jPuCECf@pP$PCf@pPCfxr ujf@p@PCplU+UfȍD+|EH/@B||;E}|EEQEfC.EfK*+xEPjM+t E+x9tvfC.p+xfC*t+upp;E}E@pECplKfApfyr u h@jPuCECf@pP$PCf@pPCfxr ujf@p@PCplE+Ef+pfC,ȋ+ppp;E}$f}@u p;E}EpEEE}~#Muh#j +vuhT#j ujPEPuG jEYPG jENPG Gf@pP$PGf@pPGfxr ujf@p@PGplEfjuutvh#j +[^_ÐGEPtQF uIuhuugN tvh4#j GE#{unG#8POAyPP<u#EEtC@ Pvh|#ju#t.SuAC@ Pvh#j#u#u1Suu#hEE9EEtC@ Pvh#jSuuGplOfApfyr uh@jPEEPGE܋EPGE؋Gf@pP$PGf@pPGfxr ujf@p@PGplOIlQu)OfApfyr Ph@GOfApfyr uh@jP]YSGO#EPu uGfjSG Gf@pP$PGf@pPGfxr ujf@p@PGplu1vh($fApP$PGf@pPGfxr ujf@p@PGplfEԋE+EE+uԉUЃ}uuu#_GplGf@p"uP PGf@pQ@PfO;EtjG$PEϋOt"u8E8Uf@+uff;EufAp.jPfPuG Gf@pP$PGf@pPGfxr ujf@p@PGplfIp8EQu[$PGf@pPGfxr ujf@p@PGplujY$PGf@pPGfxr ujf@p@PGplujhu uGplOfApfyr zh@quEEȉEuMMMM9E}EЉEju#uGplGf@p"uP PGf@pQ@PsC@+ƉEE;E~EЉEE+EEf+E܉EԋUGO$;U~5U+UԉUM܉MuVuP4NuEGO$M܉MuVuPNuEEf+U܋OfApfyr u h@jPEfEPuG Gf@pP$PGf@pPGfxr ujf@p@PGplusECEtC+C PEph$j9MuЋEphP$jE#PuU@WVS+tuh$j E=tVP5؋C Eȃ}uhh)[s#uhh)[#t }jPEPE P Ff@pP$PFf@pPFfxr ujf@p@PFplt5h@'j +[^_ÐFplNfApfyr u h@jPE PEċE PEFf@pP$PFf@pPFfxr ujf@p@PFplt5uuVuh$j}}}} MċE t&h$h)YjVLZ%MF@l;M ]MMPNfApfyr u h@jPMȋEPE؋MȋEPEEMȋEPEEFf@pP$PFf@pPFfxr ujf@p@PFpltEPEPPh%j[MMtPhD%j  ME;HD]]YoEPfʀ$f"t:f PtfPh`%j u4Sft$f PSEPEPPuh%jWEPuPuh%jiEuuTˉME;HDs]]YuWEPEPuuh%랐DEPDE#u)uuEPEPuuh(&ZE tEPt\h\&jMu t8tuG P P$_`#t(uhSuOY#t+uhSuGXf%f=uG`#t Pf%f=u#EEtw\h&j _`#lFplNfApfyr uh@jPEPEPEEPE u؋EfjEYPG jENPG Ff@pP$PFf@pPFfxr ujf@p@PFpltw\h&j jw`ujhS jhS 1tw\h&j ujSuEOENEԡtw\h&j O`#QFplNfApfyr u h@jPdjPuЋEPSE SEfjűG juԋG Ff@pP$PFf@pPFfxr ujf@p@PFplE tw\h'j GXt-GXG`#t P#tw`$t6#t#P#t$E@tw\h$'j GXt,$GXG`#t P#tw`$t5$#t#P#t$GXt G|PtPuE@Ef%EMF@l;M]PNfApfyr h@EEЋ]܃EYE̋FplNfApfyr /h@&UWVShhE9E)M< E45~ ~^S~P~UTtuh`'j F@plFHfApfyr u h@jPF TPF XPNIfIp;Qtg$PF@f@pPF@fxr ujf@p@PF@plFUF\PU$PF@f@pPF@fxr ujf@p@PF@pl~VRtuh'j F@plFHfApfyr u h@jPF DPF HPNIfIp;Qtg$PF@f@pPF@fxr ujf@p@PF@plFV^VU$PF@f@pPF@fxr ujf@p@PF@plSE9EE9EM<E45_ #wVPV$PG@f@pPG@fxr ujf@p@PG@pltuh'j VuE9EEPjE SE5PhDhb,KE;rSth'jVH E V$g G#t-P#t G f%f=uw$SV9EME<VP##PhThh,tuSh'jG@plGHfApfyr u h@jP PE SOIfIp9EQm$PG@f@pPG@fxr ujf@p@PG@plhh@;|2=thh=u 5jh =thh+[^_ËUUOX+с@U WVSh؍EPjMMtQh(j E+ 59M]UE䁺sU;s%jU+%=@Jt-EEpuhD(jE>VVEVjPG PGM Gf@pP$PGf@pPGfxr ujf@p@PGpl$cutuh)j EMEuft@f%fuj fPhW?Lut=uj hjhWaGuƇfLJuyt2Eh-Epuh)jVEVSStuh(j EME{4'ut2Eha-Epuh)jVEVSSjhu E#;#EBC#3H<#(A@IH+PEE9EEtsuh|(jEEEME_SGplOfApfyr h@GEPC fugEh -Epuh(0E4CE#@<#@@GEPGplOfApfyr u h@jPG PGEGf@pP$PGf@pPGfxr ujf@p@PGpluME; uztshH)j uC fuEh1-Epuht)M E@$t4Vh+j$"tWVh+j+^_ÐU+ÐU+ÐUWVS}GhEtWh,j u ށہE#-MMEMME;]v]#SPu =EE#uwlfGpfr uE PAQQ PfGpPSG PP8+fGpP$PfGpPfr ujfGp@PwlE+ÉE4M M++U tSPRh(,j[^_UXWVSE]}Wȡu tuSVWQh\,jdatWh,j j uVE؍d+Ҋ d"tL@B"uj SVP5FEPhfFpEFHEFh@EEfFNfE̋FDfEΊFPEuj SWJP5~WhFEuEWjSEP =uSOuj Wuh;5s=hE[^_ÐtWh,j SEӨtWh,j j }WS =Y*tWh,j jEPS =uEmhE=w=hWh-j Ed5beͺMt빐< _init > < _init: ddi_soft_state_init failed %x> < _init: e(%lx) > < _fini > < _fini: end: e(%lx) > < _info > < probe: instance(%d) > < probe > < identify: > < identify: %s: instance(%d) %s > < getinfo: cmd(%lx) arg(%lx) > getinfo: instance[%d] == -1 < getinfo: return: %s, *result(%lx) > < attach: cmd(%lx) > < %s: attach failed (cmd:0x%x, dip:0x%x) > < attach: instance(%d) name(%s) > pcxx< %s: could not configure instance %d. Re-install driver. > < %s: attach:(%d) get_soft_state failed > < attach:(%d) devi(%lx) > < attach: product(%lx) > %s_%s_%d_ncards< %s: attach:(%d) Cannot find configuration for %s (#%d) > < attach:(%d) No config info, failed attach > < %s: attach(%d) %s failed > %s_%s_%d_boardnum< %s: attach:(%d) Serial device %s (#%d) has no %s > < %s: attach:(%d) %s(%d) failed > %s_%s_%d_nports< %s: attach:(%d) Ignoring non-configured PCI %s (#%d) > < %s: attach:(%d) %s(%d) failed > %s_%s_%d_forceclose< %s: attach:(%d) line(%d) unable to allocate memory > < %s: attach:(%d) line(%d) unable to allocate memory > < attach: instance(%d) di_ch(%lx) di_nasync(%d) > %s_%s_%d_altpin< %s: attach:(%d) altpin set to off > < %s: attach:(%d) bustype is undefined > eisaisamc< %s: attach:(%d) %s is not a supported type > < %s: attach:(%d) line(%d) unable to allocate memory > < %s: attach:(%d) line(%d) unable to allocate memory > < attach: instance(%d) di_ch(%lx) di_nasync(%d) > < attach: end: instance(%lx) > < attach:(%d) end: failed > < detach: cmd(%lx) > < %s: detach fails: dip(%x) > < detach: instance(%lx) > < %s: detach:(%d) ddi_get_soft_state failed > < detach: end > line(%d): %s%s: board %x failure.< cmdb:(%lx) %lx %lx %lx > < line:%d count:%lx lbolt:%lx > < cmdw:(%lx) %lx %lx > < line:%d count:%lx lbolt:%lx > < param:(%lx) ch=%lx bs=%lx > < param:(%lx) CBAUD == B0 > < param:CBAUD > < param:(%lx) Xr set STLOW to %lx > < param:(%lx) set cflags %lx > < param:(%lx) set oflags %lx > < param:(%lx) set iflags %lx > < param:(%lx) new ixon value: iflags = %lx > < param:(%lx) set hflow %lx, was %lx, hflg = %lx cflg = %lx > < param:(%x) RTS %s DTR %s > < param:(%lx) set start-stop characters %lx %lx > < param: exit > $$ $6$6$6$6$6$#6$6$6$6$6$6$6$#6$6$6$6$6$6$6$#6$6$#< xxyinit: instance(%lx) > Could not find register property. %s: No ioaddr property for ISABUS card: attach failed. %s: No board found at port 0x%x <1>.%s: memory allocation error: port 0x%x <2>.%s at port 0x%x not resetting <3>.%s: No memory at 0x%x <4>.%s: %s at port 0x%x failed diagnostics <5>.%s: %s at port 0x%x failed diagnostics <5>.%s: port 0x%x no board found <4>.%s at port 0x%x not resetting <4>.%s: port 0x%x failed diagnostics <5>.%s: port 0x%x: BIOS failed <6>.%s: FEPOS failed <7>.%s: reconfiguring for %d channels instead of %d < init:nasync = %lx vaddr = %lx > %s port:0x%x mem:0x%x%s%d ports %s V%s line:%d, head(%lx)line:%d, count(%lx)< wmove: ch(%lx) head(%lx) count(%lx) > < wmove: exit: count=%lx > < open: q(%lx) dev(%lx) flag(%lx %lx) > < open: dev:0x%lx : Bad sflag parameter. Return ENXIO > < open: dev:0x%lx : Bad instance number. Return ENXIO > open:(%x) state structure is bad< open: dev:0x%lx : Failed board. Return ENXIO > < open: ch(%lx) un(%lx) bs(%lx) chan(%lx) crd(%d) > < open: dev:0x%lx : Bad channel. Return ENXIO > < open: dev:0x%lx : Bad board struct. Return ENXIO > < open:(%lx) !CLOSING > < open:(%lx) !ISOPEN > < open:(%lx) don't use ttymodes > < open:(%lx) do reclose logic early > < open:(%lx) reclose logic: busy=%x > < open:(%lx) waiting > < %s: open: unable to allocate resources > < open:(%lx) UN_ISOPEN > < open: q(%lx) WR(q)(%lx) rdqp(%lx) > < open: q(%lx) un_rdqp(%lx) > %s: cannot have two inodes for device %d < open: (%lx) normal end: busy=%lx > < open:(%lx) openfail > < open:(%lx) tun.un_flags(%lx), pun.un_flags(%lx) > < open: (%lx) open FAILED busy=%lx > < close:(%lx) return(ENXIO) > < close failed: q(%x) un(%x) ch(%x) bs(%x) >< close: q(%lx) un(%lx) ch(%lx) bs(%lx) > < close:(%lx) discard pending IOCTL > < close: dev %lx output printer off string > < close: free xxysched[] > < watchdog: rm %d on dev %lx at lin %d, exp=%lx > < close:(%lx) drain FEP > < close:(%lx) signal pending > < close:(%lx) signal pending > < close:(%lx) IEMPTY caused cv_signal > < close:(%lx) end FEP drain: head(%lx) tail(%lx) busy(%lx) > < close:(%lx) release flow control > < close:(%lx) exit:busy=%lx > < xxytransp:(%lx) TRANSPARENT ioctl, request size = %lx> < xxytransp:(%lx) tr_ioc_cmd:%lx tr_ioc_ptr:%lx > ioctl:(%x) badly formed un(%x) mp(%x)ioctl:(%x) badly formed un(%x) q(%x) bs(%x)< ioctl:(%lx) cmd=%lx iflag=%lx cflag=%lx oflag=%lx lflag=%lx > < ioctl:(%lx) TCSETS* ioc_cmd %lx > < ioctl:(%lx) TCSETA* ioc_cmd %lx > < ioctl:(%lx) CREAD not set: input data flushed! > < ioctl:(%lx) iflags=%lx cflags=%lx oflag=%lx lflag=%lx > < ioctl:(%lx) TIOCSSOFTCAR ioc_cmd:%lx > < ioctl:(%lx) TIOCSSOFTCAR val=%lx > < ioctl: calling param > < ioctl:(%lx) TIOCGSOFTCAR > < ioctl:(%lx) TCSBRK ioc_cmd:%lx > < ioctl:(%lx) TIOCSBRK ioc_cmd:%lx > < ioctl:(%lx) TIOCCBRK > < ioctl:(%lx) TCGETA un=%lx > < ioctl:(%lx) TCGETS un=%lx > < ioctl:(%lx) TCFLSH > < ioctl:(%lx) TCXONC flags=%lx > < ioctl:(%lx) DIGI_GETA > < ioctl:(%lx) DIGI_SETA* > < ioctl:(%lx) TIOCMGET > < ioctl:(%lx) TIOCM* setting modem lines %lx > < ioctl: calling param > < ioctl:(%lx) TCGETX > < ioctl:(%lx) TCGETX tr_ioc_cmd:%lx tr_ioc_ptr:%lx > < ioctl:(%lx) TCGETX > < ioctl:(%lx) TCSETX* > < ioctl:(%lx) TCSETX > < ioctl:(%lx) TCSETX tr_ioc_cmd:%lx tr_ioc_ptr:%lx > < ioctl:(%lx) TIOCGWINSZ > < ioctl:(%lx) TIOCSWINSZ > < ioctl:(%lx) DIGI_GEDELAY > < ioctl:(%lx) DIGI_SEDELAY > < ioctl:(%lx) DIGI_GETBD > < ioctl:(%lx) unknown IOCTL type:%lx > < ioctl:(%lx) IOCTL=%lx error=%lx > gggddddddddd{b{b{bn8b8b8b\mrp]`]`]`]`]`p8b8b< reioctl: dev=%lx ch=%lx > < iocdata: rval != 0 > < iocdata:(%lx) TCGETX > < iocdata:(%lx) GETX: hflag=0x%lx, cflag=0x%lx, sflag=0x%lx > < iocdata:(%lx) TCSETX > < iocdata:(%lx) SETX: digi_flags=0x%lx > < iocdata:(%lx) TIOCSSOFTCAR val=%lx > < iocdata: calling param > < iocdata:(%lx) TIOCGSOFTCAR > < iocdata:(%lx) TIOCMGET > < iocdata:TR_IOC_RESP response exit > < iocdata: Invalid ioctl: %lx > < wput: q=%lx ch=%lx > < wput:(%lx) stop output > < wput:(%lx) restart output > < wput:(%lx) IOCTL %lx ignored > < wput:(%lx) IOCTL %lx enqueued > < wput:(%lx) IOCTL type %lx > < wput:(%lx) M_IOCDATA type %lx > < wput:(%lx) FLUSHW > < wput:(%lx) FLUSHR > < wput:(%lx) break request > < wput:(%lx) delay request > < wput:(%lx) 0x%lx data bytes > < wput:(%lx) STOPI received iflags=%lx> < wput:(%lx) sent stop character > < wput:(%lx) STARTI received > < wput:(%lx) sent start character > < wput:(%lx) M_CTL > < wput:(%lx) CANONQUERY > < wput:(%lx) STREAMFLAGS good: flg=%lx, ct=%lx > < wput:(%lx) STREAMFLAGS not good: q_stream=%lx > < wput:(%lx) unknown M_CTL %lx > < wput:(%x) unknown type %x > < wput:(%x) unknown type > < wput: exit: q=%lx > < wsrv: q(%x) return ENXIO > < wsrv: q(%x) dev(%x) ch_bs == NULL > < wsrv:(%x) dev(%x) ch_di == NULL > < wsrv:(%lx) q(%lx) un(%lx) ch(%lx) > < wsrv:(%lx) reschedules: flags=%lx > < wsrv:(%lx) for(;;) flags=%lx > < wsrv:(%lx) output printer off string > < wsrv:(%lx) idle flags=%lx > < wsrv:(%lx) M_IOCTL goto pause > < wsrv:(%lx) M_IOCTL set and flush > < wsrv:(%lx) M_IOCTL SETAF do ioctl > < wsrv:(%lx) output printer on str > < wsrv:(%lx) output printer off str > < wsrv:(%lx) output 0x%lx data bytes > < wsrv:(%lx) output break > < wsrv:(%lx) delay for %d/%d seconds > < wsrv:(%lx) unknown packet type 0x%lx > < watchdog: add timer %d on dev %lx, exp=%lx > < wsrv:(%lx) paused: flags %lx > < wsrv:(%lx) exit > < rsrv: q(%x) ENXIO > < rsrv(%lx) Sent hangup! > < rsrv:(%x) dev(%x) ch_di is NULL > < rsrv(%lx) getq type(%lx) > < rsrv(%lx) getq: putbq type(%lx) > < rsrv(%lx) getq freed type(%lx) > < rsrv:(%lx) CREAD not set: input data flushed! > < rsrv:(%lx) bs->orun flushdata! > < rsrv:(%lx) buffer allocation failure 0x%lx bytes > < rsrv:(%lx) formed 0x%lx byte data message > < event:(%d) > < event: crd(%d) chb(%lx) head(%lx) tail(%lx) busy(%d) > < event: port(%lx) reason(%lx) modem(%lx) > < event: bad cmd=%lx > < event: did broadcast: ch state=%lx > < event: board(%x): event error (%x %x %x %x) >< event: board(%lx): event error(%lx %lx %lx) > < event: board(%x): event error (%x %x %x %x) >< event: board(%x): event error (%x %x %x %x) >< event:(%lx) modem signals %lx > < event:(%lx) got BREAK! > < event:(%lx) Flush on break > < event:(%lx) Send M_BREAK > < event:(%lx) IFDATA > < event:(%lx) IFTLW > < event(%lx) IFTEM > < event: exit xxbusy=%lx > < poll: crd(%d) wake readers > < poll: crd(%d) wake writers > < poll: vaddr(%lx) crd(%d) > < poll: crd(%d) calling event() > < poll: AFTER waketime > < xxywatchdog: check timers, mylbolt=%lx > < xxywatchdog: timer %d on dev %lx expired at %lx > < xxywatchdog: timer %d, dev %x, strclose > < xxywatchdog: timer %d still waiting > < watchdog: rm %d on dev %lx at lin %d, exp=%lx > < watchdog: rm %d on dev %lx at lin %d, exp=%lx > < xxywatchdog: port hung on dev %lx > < watchdog: rm %d on dev %lx at lin %d, exp=%lx > < watchdog: tmr %d 1 more time > < watchdog: rm %d on dev %lx at lin %d, exp=%lx > < xxywatchdog: data timer reset > < watchdog: rm %d on dev %lx at lin %d, exp=%lx > < watchdog: rm %d on dev %lx at lin %d, exp=%lx > < xxywatchdog: remove <= %d stale timers, mylbolt = %lx > < xxywatchdog: done checking timers, mylbolt=%lx > < DLopen:(devp = %lx) > < DLopen: xxyinstance[%lx] = %lx > < DLopen:(%lx) > < DLopen: %lx starting poller > < DLopen end:(%lx) xxybusy:%d > < DLclose: xxyinstance[%lx] = %lx > < DLclose:(%lx) dev=%lx > < user2board: dip(%lx) > < user2board: uaddr=0x%lx buf=0x%lx n=0x%x > < DLioctl:(%lx) dev(%lx) cmd(%lx) iarg(%lx) mode(%lx) > < DLioctl:(%x) DIGI_KME > < DLioctl:(%x) DIGI_GETDD > < DLioctl:(%x) DIGI_GETBD > < DLioctl:(%x) DIGI_GETADDR > < DLioctl:(%x) default > Copyright (c) 1988-1998 Digi International, Inc. All Rights Reserved.  $, ( $#&#'#  #`0avxpcxpcxrpcxrpcxrpcxrxemepcepcpcxxd2dansi 0 Digi Async. Driverdr_lockdr_cvkmebusydlwaitingidentifiednot identifiedsucceededfailedpcxxpcxxpcxxpcincardspcxxpcxxpciboardnumpcxxpcxxpcinportspcxxpcxxpciforceclosepcxxpcxxpcialtpinpcxxbustypepcxxpcxxpcxxpcxxuse_extended_baud_ratespcxxpcxxchbptr is NULLpcxxvaddr is NULLcm_head is badcount expiredvaddr is NULLcm_head is badcount expiredleftsetclearedleftsetclearedAccelePort C/X SBUSAccelePort EPC/X SBUSAccelePort C/X ISAAccelePort C/X EISAAccelePort C/X MCAccelePort C/X PCIAccelePort EPC/X ISAAccelePort EPC/X EISAAccelePort EPC/X MCAccelePort EPC/X PCIAccelePort Xr ISAAccelePort Xr PCIAccelePort Xem ISAAccelePort Xem EISAAccelePort Xem MCAccelePort Xem PCIPC/Xi ISAPC/Xe ISAPC/Xm ISAUnidentifiedbs_lockbrd_lockdownld_lockwaitreadwaitwriterunningregmem_lockioaddrpcxxpcxxpcxxpcxxpcxxGDpcxxGDpcxxGDGDpcxxpcxxGDpcxxGDpcxxOSpcxxOSpcxxch out of rangebs is NULLcm is NULLxxy_dip out of rangech_lockch_flag_cvtun_close_cvpun_close_cv 1.4.0pcxxbad channel infobad board infobad write countuse_ttymodes_on_openttymodespcxxpcxxwsrv: freed non-empty buffervaddr is NULLchb is NULLcm_head or cm_tail is badun is NULLch is NULL1.4.0OS@(#)FEPOS 7.08 4/20/95@(#)(C)Copyright 1989-1995 DigiBoard Inc. W S B  x P P P  ,~~~^. ~~~^.  A?f2  A?f2 @?  >U[iw\Pu<@ut&u uDfj tT uBui ƀ$t'dPDQtD)t D]ID\<DPu(|$t+D&=dwDu$DudPdKt%Du DuD$D&dPdKLPLKT "DR:DSu| ;| tD&G#|| ƀ$t dPdKƀ$T "DR:DSu:| ;| tD&G#|| "\b2.t dPdKuƀ$aD*u9'BD*u+(4D*u!&D*u)D*u^ D*uDa\LP@DT "DR:DSudPD0DaD*u, D+@uD+usD0tL0D+ uYk"\+uD0%D06uW D0%D0+Ht8D2LP@DT "DR:DSu L2udPuD0%D0+=|D0%D0D* uCD*tBD*tD0t0 LP@!D!pT "DR:DSudP + D+uBUD*uD*t|0t"\+uD0uD0=ru D0D*@tE= w@=~\2LP@DT "DR:DSuD`l2~PD2LP@D  T ȰtD2D00bT ȡ+D2=wdPFt:dPdK,T "DR:DSu| ;| tώD&G#|| u&ƀ$D0uƀ$T tDI|D0#D4d"\QuD)t!D) u+|^uDX Vu.utkDb KDS 4|^uD D t*LctuD)t!D) u!|^udQu녀dQ|^uORdQdS?dTLXdQD)@u,:D]t':D\t"D) t :DZt:D[tD^t :D^uLQ:D^t}:D\t=:D]tU:DZt:D[tDS@tdS:D[t{LS@D)tpLQDeDStdSdTLXP:D]tHLSLTLXD)t5LQD*LQD:D^t:D\t:D]t=s&#|;|tOtN|+|#|;|sFƀ$ u "\(u̪#|;|t#|;|tD(uD(uP2O#||DYDQtƀ$LQ"D_"DuDuD)tLTLXtPƀ$&G#|;|t2D)t .&=G#|;|t#|;|t..`.`T 2.T "aρ΀T  Dq$DqDILP T 뮁΀T " yzLQDDcDQtdQdS?D(uYD(uO|ÎDD(t#|;|t&2D)t#|;|t2#|;|tÉ|O#||DYLOT .PRUF2"  >t1+;r# ; t> t "]ZXϰ  .(Un.].$Un.]> uP  $X`"...0 &.@CABFGE..= X^a| +| #|;|w.DMLOZ| ;| u> ;> uSDKuMDLLOCDPu< | +| t1LPLK#6T \T2DMuDLuDPt2".xlIrE|+|t"|Nt#|;|sC+Ln;L"s7|It1DQu<2"80aDq DqdPDNLnLO뾋|+|#|;|sdQD)tdTLXtP"D_ DuDu60#D.tр@ "\U0\T2|U \X\X"\Vu$|Ou"t6&> ;> uFLO > DHdODTdW;> tDWDODV DX> ,> ].T t .*> 6 ;6 t6 > >  W/W;T5}8 WWWWWWWWED렋ED똋E\ +\ #\L +#L;v#DD wLSLTLXhdS?dTLXdQUEDZd[IE tD$LPLK0]"|T ߊDT2$0DTDu2؊|_"߀2ÈDu]udS?dQD)2ǨtDQttP\(|)`tDb t$D4DED\d]ED$ DQuAD+D#D;Dr3LQD)tLTLXtPD_tDu"d_"ĈDuODQt?D+D#D;DsdQD)tdTLXtPD_tDu"d_ ĈDuE'RPE:" r ; wED*d+ udPDPu LPD0uD`D`]"|_ ߊ\_DRdS3ȁ883DRdS"\TDQu ߊDu2؀2ÈDuL]\,|-˃ۀ> u =21su.i.u.).I ÈD| LjD}D@t t t u Dtـ02.Ds$? ĈDsDu$ ĈDu.DbD( t$D4ED^xEZ6& 6$ `6 ? Z.I&&Mr& &Mr،ځ" 3D D DDƀ6 г" +r)Dƀ" +rDƀrʊ" |DHDƀ" |DHDƀ D-DHD D DDDDD\Hۋ T LHD.D$D&DJD0D2DLDMDNDODPDKDQD(D)D*D+DTDWDUDVDXDRDSD_D,=D-D4`DbD]D\D^D`#Da# u LHDpDqDH$DrDsDDt`DuDvDwDx DyDz RD{> u! =21s D| D} D| D}D~DDs DsDu Du%м%؀>@ uQ =02sG # # t# "  󥿠  p@   .$ Z &   Dƀr" 6 )DRPV^@f@        28:<>>" v2(l"3 O! S6 < c@(#) $Id: xacook.asm,v 7.25 1995/01/12 20:59:21 milt Exp $(C) Copyright 1994, DigiBoard Inc.$ 40D@TPd`tp."pPR."q"ZXϴ."+RP."*>*r9*)>)('r '%"XZ`."."6@#t & t & t & t &$@^fRcV(&.&,:u&>GDBIOSXi&>tXe&>tXt66$&=DGu &.,EMu& .,ﺤ:`u $t<t<t$8"8A8Ὼ 8AﺢﺦﺨȎ$t<tZ<tSN&|&;u(&;u&;uȎм%lt.."$&&t&&@&t&U&&&́&;u&@мȎм| ttŀt& &&@м`uU&&&&;u$&`fu &@&Ō=u=tb=t#&|.u&@&rк=u|& PQYXu&@& 8=u|& PQYXu&@& &-&3ǹ3$ GGd&(2 468:< >>6f>66&2 Ê&6& :u& > &"3&ǃ&&#6&2 Z LIPVT`udhl +074@8O<X@dDoHyLPT`dh(($  H , $ D )5DO4_D#Ziyt)d _ 8 l@x$p 6?KV_ms{  < 0h +6JR] ]s,~P0XP @ t d|p)H  H+8>hJ\ Ybuorx {x   $z, P(T 8; JV$ esTD H H Hp4  P *0x <=PF X`m X t1 44h0( | (1>K\iz\ H 0 X   l ! ( < G @ V H4a ` p             L  (  pcxxxxy.cDdata.dataBbss.bssDrodata.rodatapcxx_copyrightpcxxnschedpcxxnservicepcxxschedpcxxactive_watchdogspcxxwatchdog_freqpcxxwatchdog_timerpcxxwatchdog_cleanuppcxx_bufpcxxprobedpcxxinstancepci_xem_seqpci_epc_seqpci_pcxr_seqpci_cx_seqpci_avxp_seqsbus_epc_seqpci_product_listpcxxcurrentpcxxncrdpcxx_tot_portspcxxbusypcxxpollingpcxxpollidpolltickskmebusyerr_countxxybusywaitextbaudrate_maskuse_extended_baud_ratespcxx_infopcxxrinitpcxxwinitdigi_initpcxx_init_ccmod_cb_opsmod_dev_opsmodldrvmodlinkagepcxx_devspcx1waitingpcxx_auto_listpcxxkennelsend_part_canonbrd_namefpcxxusertoboardxacook.cxabios.cpcxxDLioctlgetminorpcxx_biospcxxwrite_debugbzeropcxxioctlpcxxclose_debugddi_getbddi_getlpcxx_config_regqprocsoffddi_getwpcxxopencv_wait_sigpcxxfepsync_debugpcxxcmdbmutex_entercv_destroypcxxcmdwpcxx_ext_baudbcopynulldevddi_rep_getbdelaypcxxdetach_debugpcxxfailmutex_destroyddi_rep_getloutbpcxxDLopen_debugddi_rep_getwpcxxinfoddi_regs_map_setuppcxxioctl_debugpcxxparampcxxres1_debugmutex_exitddi_soft_state_freeqenablepcxxtranspddi_soft_state_zallocpcxxattach_infokmem_zallocpcxxprobepcxxkmebusy_cvpcxxpoll_debugmod_installpcxxwputcanputputqpcxxwatchdog_debugpcxxdigikmecopyout_initpcxx_ncookpcxxrsrv_debugxxyrep_getcv_broadcastnodevpcxxDLclosepcxxflow_debugqprocsonpcxxidentifyRDpcxxrsrvpcxx_init_debugpcxxDLres1_debugpcxxident_debugddi_get_soft_stateflushqpcxxinitddi_getpropnochpollpcxxinit_debugcv_initddi_get_namepcxxgetinfoddi_soft_state_finipcxxmodem_debugWRpcxxcmdb_debugpcxxdr_lockpcxxcmdw_debugmod_driveropsddi_prop_opinbpcxxmemlockkmem_freepcxxwsrv_debugpcxxeventpcxxdevflagtimeoutstrncmppcxxattach_debugputnextpcxxpollpcxx_cookpcxx_dip_ptrpcxxopen_debuguntimeoutpcxxcloselboltpcxxiocdatapcxxwmovepcxxDLioctl_debugfreemsgdrv_usectohzpcxxDLwrite_debugputbqbufcallpcxxbreak_debugallocbpcxx_nbiospcxx_info_debugpcxxDLopenpcxxwsrvpcxxhowlmod_infoddi_putbpcxxparam_debugddi_putlpcxxDLwritegetqpcxx_fini_debugddi_putwddi_rep_putbddi_rep_putlddi_get_instanceddi_rep_putwpcxxdlwaiting_cvdrv_getparmpcxxdr_loadedstrcmpputnextctl1pcxxdetachpcxxwatchdogpcxxwmove_debugpcxxdl_loadedddi_regs_map_freepcxxDLread_debugpcxxDLclose_debugpcxxres2_debugcopyinddi_soft_state_initpcxxDLreadpcxxwput_debugxxyrep_putpcxxread_debugddi_getlongproppcxxprobe_debugputnextctlmod_removeqreplypcxxgetinfo_debugpcxxdr_cv_finicmn_errcv_waitunbufcallcanputnextpcxxevent_debugpcxxdelaypcxxreioctlmutex_initBE built: Oct 4 1996 15:09:56 GMT@(#)xxy_defs.h 1.32 98/09/26$Header:$@(#)types.h 1.63 98/04/28 SMI@(#)isa_defs.h 1.15 97/11/22 SMI@(#)feature_tests.h 1.17 97/12/04 SMI@(#)machtypes.h 1.7 96/05/23 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)int_limits.h 1.5 98/01/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)types32.h 1.4 98/02/13 SMI@(#)select.h 1.16 98/04/27 SMI@(#)param.h 1.63 98/06/03 SMI@(#)ioctl.h 1.9 92/07/14 SMI@(#)eucioctl.h 1.10 93/11/01 SMI@(#)systm.h 1.93 98/06/03 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.19 98/02/27 SMI@(#)time.h 2.62 98/02/04 SMI@(#)time_impl.h 1.3 98/02/13 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)thread.h 1.89 98/06/07 SMI@(#)klwp.h 1.34 98/01/06 SMI@(#)condvar.h 1.10 98/02/18 SMI@(#)signal.h 1.53 98/06/30 SMI@(#)unistd.h 1.36 98/07/16 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.8 98/02/05 SMI@(#)faultcode.h 1.15 92/07/14 SMI@(#)pcb.h 1.13 98/06/08 SMI@(#)reg.h 1.15 97/11/05 SMI@(#)msacct.h 1.7 93/07/13 SMI@(#)ucontext.h 1.6 96/04/24 SMI@(#)regset.h 1.1 89/10/03 SMI@(#)lwp.h 1.30 98/01/06 SMI@(#)synch.h 1.35 98/06/05 SMI@(#)proc.h 1.117 98/03/19 SMI@(#)cred.h 1.21 97/01/09 SMI@(#)user.h 1.56 98/06/30 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)model.h 1.20 97/09/22 SMI@(#)debug.h 1.22 97/05/15 SMI@(#)auxv.h 1.26 98/01/13 SMI@(#)errno.h 1.19 98/01/14 SMI@(#)timer.h 1.16 98/01/06 SMI@(#)watchpoint.h 1.6 98/01/06 SMI@(#)seg_enum.h 1.3 95/12/22 SMI@(#)copyops.h 1.3 97/07/07 SMI@(#)segment.h 1.13 98/01/06 SMI@(#)dditypes.h 1.26 98/03/04 SMI@(#)varargs.h 1.44 97/11/22 SMI@(#)va_list.h 1.11 97/11/22 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)sysmacros.h 1.35 98/06/03 SMI@(#)termio.h 1.11 96/02/07 SMI@(#)termios.h 1.38 98/02/20 SMI@(#)ttydev.h 1.7 92/07/14 SMI@(#)termiox.h 1.9 92/07/14 SMI@(#)stermio.h 1.8 92/07/14 SMI@(#)stropts.h 1.44 98/04/28 SMI@(#)conf.h 1.57 98/01/06 SMI@(#)devops.h 1.37 98/01/06 SMI@(#)uio.h 1.29 97/06/29 SMI@(#)buf.h 1.43 98/07/14 SMI@(#)kstat.h 1.14 98/01/06 SMI@(#)poll.h 1.26 98/06/12 SMI@(#)as.h 1.68 98/06/04 SMI@(#)seg.h 1.54 98/05/25 SMI@(#)vnode.h 1.80 98/08/03 SMI@(#)hat.h 1.81 98/03/13 SMI@(#)page.h 1.112 98/06/29 SMI@(#)ddidmareq.h 1.25 98/01/24 SMI@(#)ddimapreq.h 1.14 96/06/25 SMI@(#)mman.h 1.36 98/06/04 SMI@(#)ddipropdefs.h 1.12 98/01/06 SMI@(#)ddidevmap.h 1.8 98/03/13 SMI@(#)nexusdefs.h 1.13 94/08/09 SMI@(#)aio_req.h 1.2 94/11/11 SMI@(#)stream.h 1.79 98/06/11 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)strtty.h 1.11 98/01/06 SMI@(#)strsubr.h 1.103 98/01/06 SMI@(#)session.h 1.13 96/09/29 SMI@(#)anon.h 1.66 98/07/06 SMI@(#)fcntl.h 1.44 98/06/04 SMI@(#)stdigi.h 1.22 98/07/08$Header:$@(#)pcxx.h 1.4 97/08/13@(#)stat.h 1.28 98/03/24 SMI@(#)modctl.h 1.54 98/08/10 SMI@(#)ioccom.h 1.14 97/10/22 SMI@(#)cmn_err.h 1.27 98/01/06 SMI@(#)kmem.h 1.26 98/01/06 SMI@(#)ddi.h 1.32 98/01/06 SMI@(#)map.h 1.23 98/02/25 SMI@(#)sunddi.h 1.90 98/06/29 SMI@(#)ddi_implfuncs.h 1.21 98/01/06 SMI@(#)ddi_isa.h 1.14 98/06/08 SMI@(#)devctl.h 1.10 98/02/25 SMI@(#)dma_engine.h 1.9 98/01/06 SMI@(#)version.h 1.1 93/10/14$Header:$@(#)xxy.c 1.58 98/09/26$Header:$acomp: WorkShop Compilers 4.2 30 Oct 1996 C 4.2hc2.8h -O0 -386 -fstrict -on SHAREABLE xxy.cas: WorkShop Compilers 4.2 30 Oct 1996acomp: WorkShop Compilers 4.2 30 Oct 1996 C 4.2acomp: WorkShop Compilers 4.2 30 Oct 1996 C 4.2<C4 <B4 <B4.text.rodata.data.bss.symtab.strtab.comment.stab.index.shstrtab.rel.text.rel.rodata.rel.data.stab.indexstr8+8Kn=8z882DmD:=^&>L ): (*''X b 8&o y -L# ( * &##38$$37/.476].! # M%5%e%##&\ #<3&+Qg#r,k7rL7*,G7%%:71171#%v#$$~-<4, $- # #- #E.h###%#%I }&LmPc Q N   $MR-QQPQPa VA3GN>T=NND=>p7@TVoWTLZSB[p[]^m(_  }N_-_r`@wb@bY f Sxf(B0ghhklommn&n%pqrIrAb.@@AmJ.77s2LCt= u>uvwx3  3xxj y+zVz{\|e}W~/,B W҂ , ҄0pCTdCCYqҍ)Da*TCE.YKKf]//L?  *Q ]ST2 ?pfQ]Ҹ1 ӶbLnq&Ėc&`"=&ݓL٪Acҩi#&8*˙2$ &(j oۥ5 !•E !!$=&"PMHGSSZ^TSSS TSrQџ|?G39@3gTAݰZq.  tNA %%%%G8% % %l&+&|&Q&&f&}&& && &V'^'D'" '`(B(i(C(K(S(Q(({(P((Q(X(R(B))))B)y)C**3***Q++s---Q.g...^/!//V /o00;"0b00g0g84_E599o9:::= ::::@:::::: :c::oA:2 <>=====-===== ======\==|= ====9==(=`T==:T= ==/T==T===~========={===`=ğ=ʟ==ן= p"VgVTcVC L Ǔuvvrv!vDvvvvYv%TvvvOvOvvvvvvtvZPYPrKP(ci"! ?G V$ ))$3X@>CBD|PPaPLB[BlEBAMKZACHL(OXCL@@Y[IQ[I[IZIYITISIRSISI:RIQIQIpdwdz}dH~ddd{d]dx^dpdzd_ddnd_`dmdmdGzdbd_mdqdldkddfdrdQfdd/tdfd%gdhdكdxdixddwdhdvddd/udHō3n@ /`ϧ̥^Tê{{5{k{Ʃ{={ϲ{Q_LTIE~qHq&qq!qT G' W L [![ [V```:`A`a6 /   e^bk ?kCj{J xu *RT>QTc TTkB&QGQYClTiR!p(pR a57{ Kɝ]4U^=X09YTmW;&% u d%<.<=<%(Y+NN'N<NZNVN1N_INjN|NeNǴN*NU0NI\N6NN4NN-NN,N.N7N|5NN=N>N%.NNh,N$:NJNNʒN1NZNNNqNN:Nv:NA:NN2NNTNĚNlNQ6N :NUN9NN9N9N[NNNZN<NVN~N }NRN66NjN0NNj6NFNNNjNNNNN3INJ6J6JiJJJJuJ̮JVJIJJ8JZJJmJUJ-[J^pj$6/0///?6^e/t2KI6ej W 101Q `31Ƽܼ6L=j f{f^~}lc|r8%)%%$888&<q%Y%A%٧NYaXInYxB֝U"K+]t|SS=SPS*SS؀SSSYS[S>S=SS~SySSQSGS{SS}SSS}S S|S|S SS]SASSpSS?S1S;BSSSpShSCSSS)SKS[S)SCwSSS$RSfRSk!S0SSfSoSvBSŇSSSSS iSfoSZStS(SLS%rS4S S>S*SS SHS3SASSSSSSpSXS-iSS@fSuSuSSSWTSESÌSGSS fSBS+S!SSWS+S|TSSS`tS S4HSsSTSkSS#SsS?SHSSSFSFSdSTS"sSS6SHSSsSSlSHS?S͏SdSBqSrSNUSrSSS OSSS SNSSlSIVSMS%SSSSοSpGSSkSS^S lSSMSskSSSӾSMSLSSSXSSSXS\S:SSSSqSSSڻSdLSSSeJSZS@SSJSoSKS:bSShSSyaSSkS3S\S_SnSyS^SSFSSۙS$S:oSSSM]S3S`lSlSlSnS{StSfSRFS\S`FSѵSSSJSShSnS=TTT<T<T T<T<T:T-T<TT<T T T T ogH@gnggژgngwlgP@g4FgEgg(GgIlgLgngLogOgZggIg?gg`g gQgKvgwgAgSBgggBggXgg|gqggҁgTGgggPkgqg+gigAg'ggpgg2kggjrgݏgggg sg+gFg.sgf=g*g>gGggMsgg5#gasg"g<|gjgCggCgg!gtgr>gtggggzggg׌ggBgуgg܊g(AgTggg!ggCvgxogggnBgCggi}ghg2=gAgEagUMggRggrg+g(ga gL!gegggHggIggUgg gIfg<g gggg0fgng gsggegPggg?QgegLQg7g9gg=gĻg`gHgg6ggTgܨgQgGg ggNgOgTggggoggdgg g9JgNgpgKg[gngggDJggeg"Lg|gg[gag gggJgagggIgvgKggqTg=agNgnggkgg^ggXgWggg@WgZgz ggg`ggggQg@g<ggdggn]gggggg gggg9g gg\ggXgWg\g Og3ggȰggQggSgggWgggTg!gggn_gg^_goSggMgO gCg^gggMg1]gAggB h hh ]i<]{ ]x<]<]<]<]B]4<] ] ]]t 4B{DrD@D\DDhtAE"yD&skEl  %x39  d33n3n nE n  u  RrQ7jZ/KZeiliֹiVi&i i@riari iiBiii[iiνiii^ji,i}}>}Q}]}Fj}߷}wY}*}}}x};}C}}n'OZh(8: 2S'&'/2Mb\p:FO9n9*/L81j7'g1q!Ưd2ɭI/L(` 'V00PN.cIAXjeiMcWgU 6E4;u,E=-**5q)%}.>62;+4ІUj4;2 ).6)7+ ?@+.5-+sL)5n)3J5R5K4j-m_`_)_Q_2__3(_%_X(___W_n__5_xq_(_p_hZ_*_Ί_(3_W_d_2_tU_(_5\_@__q_{\_W_q_._4_-__U__4__{_^_H2__;_(Z_h__U_2__3_P_a__2W_____`_W1_8_e_C_5v_E__,_E1___Z_"__e_R_____/_4___R_ '_1_`_R__`5__0__W_p_:_|__߯_P__M+_}_5_5______%____\__e_`_a_+-_@_/a_̘___Ѭ_$_]_@_+_A_u_ѫ_5_@_͜_mV___5_-_J_0_T_|_v_$k_Ğ___+_q_k_pj__d_e_e_ j__i_f__i_Ti_4_,_O,_w__<0_ء_*0___Ƣ_6____[}__>}_I_(__n_|_=_6_G>_d>__,?_$_>_?_@_:@_<__;_;_:_:_#_9_F_F_N_GM_G_I_J_+J_*M_L_8_N_iN_L_2__7_st?OO |Dmkpvs~{uvz^xpnmyGDG#G8GTEGGGP8x?Y4!XR&y_{hu~ `s|Jy5Op!^ڕҠƗ-SPnk$mqeGk9qf{֐SP_v]ƽOKfjkKuWl(lϻD%hK)K)KKKOK|+-{*X+*-*Ee+E-E0z.z/z/C& C+}Y/PWdEWpWdWIdWaWDWdWUPWKM]MWQMQMO^oWo+onn ݁no^rzIV(txx  , (  $        <    @  $ ( , 0 |04 8<@4 x8 HL LH PTX\D`D tplhd|(l D`(   t X < !"1123 6, 7H 8uOs b$  X X ~ ~ ~ ~ ~ ~ ~ ~ ~ ~     o l xxy.cXa ; O ; V=3.1 ; R=WorkShop Compilers 4.2 30 Oct 1996 C 4.2/net/cts8/export/home/ews2/pcxx.140; /opt/SUNWspro/bin/../SC4.2/bin/cc -DSOL -DX86 -DPCXX -DISA -D_KERNEL -O -c xxy.c -W0,-xpxacook.cXa ; V=3.1 ; R=WorkShop Compilers 4.2 30 Oct 1996 C 4.2/net/cts8/export/home/ews2/pcxx.140; /opt/SUNWspro/bin/../SC4.2/bin/cc -c fep5/xacook.c -W0,-xpxabios.cXa ; V=3.1 ; R=WorkShop Compilers 4.2 30 Oct 1996 C 4.2/net/cts8/export/home/ews2/pcxx.140; /opt/SUNWspro/bin/../SC4.2/bin/cc -c fep5/xabios.c -W0,-xp89- x188C"G% *)Q 3^l ?<_xI _@OS _ İit 07070100060e28000081ff00000000000000000000000136434eab00001ec4000000ad0000000400000000000000000000001900000004root/tmp/pcxx/pcxxconfigELF44 (44  ~~ /usr/lib/ld.so.17%2(',1&.6)0-3+45# !$*/"ԀH8HX     X\|  \ ؈| # 0FMRZ' `hqȈx |!    `  * _start_mcountatoi_environ_end_ex_register_GLOBAL_OFFSET_TABLE_atexitexitsprintf_init___Argv_DYNAMICprintf_ex_deregisterenviron__fpstart__fnonstd_used__longdouble_used_edata_PROCEDURE_LINKAGE_TABLE___fsr_init_value_etext_lib_version__fsrmain__environ_lock_finilibc.so.1SYSVABI_1.3libc.so.1 7*0i0\ `)"+#($5%%h%h%h%h%h %h(jjRthET|RU RPs&y PkjÐURQ|$fd$ʁ3D$с` r*f T$сf T$сf T$l$  f T$l$5u YZ]U3=$':182;+<7-/&96.%" 5(0*!4)#,ԀTt Ȋ  ܍  (l 0ƟȊ , 0Ɵ# 0(FM$R4Ya' gtmTuL}l 0!TDPƟ  & #0 ) .4=܍* Cd_start_mcountatoi_environ_end_ex_register_GLOBAL_OFFSET_TABLE_atexitexit_xstatsprintf_initumask_fxstat___Argv_DYNAMICfscanf_ex_deregisterenviron__fpstart__fnonstd_used_lxstat__longdouble_used_edata_PROCEDURE_LINKAGE_TABLE_fopen__fsr_init_value_etext_lib_version__fsrmain__environ_lock_fini_xmknodlibc.so.1SYSVABI_1.3libc.so.1K7U696!-4#8/<$@%D1H)L=P(T5X\,`&5,%0%4h%8h%<h%@h%Dh %Hh(%Lh0%Ph8p%Th@`%XhHP%\hP@%`hX0jjRlt'h܍ET0RU LRP& PjÐURQ|$fd$ʁ3XD$с` r*f T$сf T$сf T$l$  f T$l$5u TYZ]UE PEPjG EEÐUE PEPj' EEÐUE PEPj EEÐUEPE PEPjEEÐUE= jnjE h @PEE @PEEP@PhEP=@Phh P`P P='E EEEPh! P EP@Ph EP =ljvS[n<у:tQ[S[F@у:tQ[r%s %d%s%s%s %dl *:JZjz(a  ܍oTo  (`tȊ   $04( ,8<!%15 ) -9=Copyright (c) 1988-1993 Digi International, Inc. All Rights Reserved./dev/ԀTt Ȋ  ܍  (l 0ƟMƟ Ȋ ) 4:;X FRSTUVWcxFk؋ p v8 |h  ( Ȋ , 0Ɵ ($"4)1' 7t=TELSl\c r0!zTDPƟ  & 0  4܍* dpcxxmknodcrti.s_ex_shared0_ex_text0_ex_range0fsr.strap_tablevalues-Xa.cpcxxmknod.cCopyrigstatlstatfstatmknod.L161.L166.L168.L169.L172crtn.s_ex_shared1_ex_text1_ex_range1_start_mcount_START_atoi_environ_end_ex_register_GLOBAL_OFFSET_TABLE_atexitexit_xstatsprintf_initumask_fxstat___Argv_END__DYNAMICfscanf_ex_deregisterenviron__fpstart__fnonstd_used_lxstat__longdouble_used_edata_PROCEDURE_LINKAGE_TABLE_fopen__fsr_init_value_etext_lib_version__fsrmain__environ_lock_fini_xmknod <E4*@(#)dgiimknod.c 1.2 98/07/08$Header:$@(#)types.h 1.61 98/01/22 SMI@(#)isa_defs.h 1.15 97/11/22 SMI@(#)feature_tests.h 1.17 97/12/04 SMI@(#)machtypes.h 1.7 96/05/23 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.14 97/12/22 SMI@(#)time.h 2.62 98/02/04 SMI@(#)time.h 1.35 98/02/04 SMI@(#)time_impl.h 1.3 98/02/13 SMI@(#)stat.h 1.27 98/01/21 SMI@(#)stdio.h 1.65 98/02/06 SMI@(#)va_list.h 1.11 97/11/22 SMI@(#)stdio_impl.h 1.6 98/02/06 SMIacomp: WorkShop Compilers 4.2 30 Oct 1996 C 4.2ld: Software Generation Utilities - Solaris/ELF (3.0).interp.hash.dynsym.dynstr.SUNW_version.rel.text.rel.ex_shared.rel.plt.plt.text.init.fini.rodata.rodata1.got.dynamic.exception_ranges.ex_shared.data.data1.bss.symtab.strtab.stab.index.comment.shstrtab.stab.indexstrpcxxmknod.cXa ; V=3.1 ; R=WorkShop Compilers 4.2 30 Oct 1996 C 4.2/export/home/davidz/pcxx.140; /opt/SUNWspro/bin/../SC4.2/bin/cc -c pcxxmknod.c -W0,-xpmainԀ  oTT - tt  7  F  ` O TȊ Z '`܍ *fn  w((D|ll   00Ɵ=!0  ,8*07070100060e2b000081a400000000000000000000000136434eae00001fef000000ad0000000400000000000000000000001700000004root/tmp/pcxx/stdigi.h/* ex:se ts=8 sw=8: */ /************************************************************ * Copyright (c) 1988-96 Digi International Inc., All Rights Reserved. * This software contains proprietary and confidential information of Digi * International Inc. By accepting transfer of this copy, Recipient agrees * to retain this software in confidence, to prevent disclosure to others, * and to make no use of this software other than that for which it was * delivered. This is an unpublished copyrighted work of Digi International * Inc. Except as permitted by federal law, 17 USC 117, copying is strictly * prohibited. */ #ident "@(#)stdigi.h 1.22 98/07/08" #ident "$Header:$" /************************************************************************* * Legal flag values for digi_t.digi_flags defined * in the structure below. */ #define DIGI_IXON 0x0001 /* Handle IXON in the FEP */ #define DIGI_FAST 0x0002 /* Fast baud rates */ #define DIGI_RTSFLOW 0x0004 /* RTS input flow control */ #define DIGI_CTSFLOW 0x0008 /* CTS output flow control */ #define DIGI_DSRFLOW 0x0010 /* DSR output flow control */ #define DIGI_DCDFLOW 0x0020 /* DCD output flow control */ #define DIGI_DTRFLOW 0x0040 /* DTR input flow control */ #define DIGI_COOK 0x0080 /* Cooked processing done in FEP */ #define DIGI_FORCEDCD 0x0100 /* Force carrier */ #define DIGI_ALTPIN 0x0200 /* Alternate RJ-45 pin config */ #define DIGI_AIXON 0x0400 /* Aux flow control in fep */ #define DIGI_PRINTER 0x0800 /* Hold port open for flow cntrl*/ #define DIGI_PP_INPUT 0x1000 /* Change parallel port to input*/ #define DIGI_RIFLOW 0x2000 #define DIGI_422 0x4000 /* for 422/232 selectable panel */ #define DIGI_PLEN 8 /* String length */ #define DIGI_TSIZ 10 /* String length */ /************************************************************************* * I_CTL values to pass when setting DIGI parameters. */ #define DIGI_GETA (('d' << 8) | 128) /* Read params */ #define DIGI_SETA (('d' << 8) | 129) /* Set params */ #define DIGI_SETAW (('d' << 8) | 130) /* Drain & set params */ #define DIGI_SETAF (('d' << 8) | 131) /* Drain, flush & set params*/ /************************************************************************* * Some of the following are not defined in various versions of * the operating system. */ #if !defined(TIOCSSOFTCAR) #define TIOCSSOFTCAR (('d' << 8) | 146) /* set CD state flag */ #endif #if !defined(TIOCGSOFTCAR) #define TIOCGSOFTCAR (('d' << 8) | 148) /* get state of CD flag */ #endif /************************************************************************ * Ioctl command arguments for DIGI parameters. */ #define DIGI_KME 0x6562 /*(('d'<<8) | 98) Read/Write Host */ /* Adapter Memory */ #define DIGI_GETFLOW (('d' << 8) | 150) /* Get startc/stopc flow */ /* control characters */ #define DIGI_SETFLOW (('d' << 8) | 151) /* Set startc/stopc flow */ /* control characters */ #define DIGI_GETAFLOW (('d' << 8) | 152) /* Get Aux. startc/stopc */ /* flow control chars */ #define DIGI_SETAFLOW (('d' << 8) | 153) /* Set Aux. startc/stopc */ /* flow control chars */ #define DIGI_GCLOSE (('d' << 8) | 154) /* get close time to */ /* wait for data to drain */ #define DIGI_SCLOSE (('d' << 8) | 155) /* set close time to */ /* wait for data to drain */ #define DIGI_PSETA (('d' << 8) | 161) #define DIGI_PGETA (('d' << 8) | 164) #define DIGI_PRESET (('d' << 8) | 165) #define DIGI_BRESET (('d' << 8) | 166) #define DIGI_TCXONC (('d' << 8) | 167) /* ldterm intercepts TCXONC */ typedef struct fw_tunable fw_t; struct fw_tunable { short carr_wink; short brk_cnt; short brk_det; }; typedef struct digiflow_struct { u_char startc; /* flow cntl start char */ u_char stopc; /* flow cntl stop char */ } digiflow_t; /************************************************************************* * Structure used with I_CTL to read/set DIGI special * tty parameters. */ typedef struct { u_short digi_flags ; /* Flags (see above) */ u_short digi_maxcps ; /* Max printer CPS */ u_short digi_maxchar ; /* Max chars in print queue */ u_short digi_bufsize ; /* Buffer size */ u_char digi_onlen ; /* Length of ON string */ u_char digi_offlen ; /* Length of OFF string */ char digi_onstr[DIGI_PLEN] ; /* Printer on string */ char digi_offstr[DIGI_PLEN] ;/* Printer off string */ char digi_term[DIGI_TSIZ] ; /* Terminal string */ } digi_t ; /************************************************************************ * Digi International KME definitions and structures. */ #define RW_IDLE 0 /* Operation complete */ #define RW_READ 1 /* Read Concentrator Memory */ #define RW_WRITE 2 /* Write Concentrator Memory */ #define RW_PAUSE 3 #define RW_RESET 4 /* Reset the indicated concentrator */ typedef struct { u_char rw_req; /* Request type */ u_char rw_board; /* Host Adapter board number */ u_char rw_conc; /* Concentrator number */ u_int rw_addr; /* Address in concentrator */ u_short rw_size; /* Read/write request length */ u_char rw_data[128]; /* Data to read/write */ u_char rw_reserved; /* Reserved for expansion */ } rw_t; /************************************************************************ * Structure to get driver status information. */ struct digi_dinfo { u_long dinfo_nboards; /* # of boards configured */ char dinfo_reserved[12]; /* for future expansion */ char dinfo_version[16]; /* driver version */ }; #define DIGI_GETDD (('d' << 8) | 248) /* get driver info */ /************************************************************************ * Structure used with ioctl commands for per-board info */ struct digi_info { u_long info_bdnum; /* board number (0 based) */ u_long info_ioport; /* I/O port address */ u_long info_physaddr; /* memory address */ u_long info_physsize; /* Size of host window */ u_long info_memsize; /* Amount of installed memory */ u_short info_bdtype; /* board type */ u_short info_nports; /* number of ports on board */ char info_bdstate; /* board health */ char info_reserved[7]; /* future expansion */ }; #define DIGI_GETBD (('d' << 8) | 249) /* get board info */ #define DIGI_GEDELAY (('d' << 8) | 246) #define DIGI_SEDELAY (('d' << 8) | 247) #ifdef CHFEPPOLL /* * The FEP event polling rate is variable within a tight range of * values. The mechanism dictates that the values passed by these ioctls * represent a FEP event polling rate in integral milliseconds. * * The mechanism: * * GFEPPOLL: Returns the current polling rate in milliseconds. * Adapters which do not support this functionality * will return "0". * * SFEPPOLL: Sets the fep event polling rate in milliseconds. If the * value is out of range, the closest boundary value is * substituted in its place by the driver. The current * range is between 1 and 20 milliseconds, with the FEP * defaulting to 10 milliseconds. The value returned by GFEPPOLL * is ONLY valid once at least ONE polling interval has passed * since the last SFEPPOLL command was submitted. */ #define DIGI_GFEPPOLL (('d' << 8) | 245) /* get event polling rate */ #define DIGI_SFEPPOLL (('d' << 8) | 244) /* set event polling rate */ #define FEPPOLL_MIN 1 /* minimum of 1 millisecond */ #define FEPPOLL_MAX 20 /* maximum of 20 milliseconds */ #endif /* Board type definitions */ #define SUBTYPE 0007 #define T_PCXI 0000 #define T_PCXM 0001 #define T_PCXE 0002 #define T_PCXR 0003 #define T_SP 0004 #define T_SP_PLUS 0005 #define FAMILY 0070 #define T_COMXI 0000 #define T_PCXX 0010 #define T_CX 0020 #define T_EPC 0030 #define T_PCLITE 0040 #define T_SPXX 0050 #define T_AVXX 0060 #define BUSTYPE 0700 #define T_ISABUS 0000 #define T_MCBUS 0100 #define T_EISABUS 0200 #define T_SBUS 0300 #define T_PCIBUS 0400 /* Board State Definitions */ #define BD_RUNNING 0x0 #define BD_REASON 0x7f #define BD_NOTFOUND 0x1 #define BD_NOIOPORT 0x2 #define BD_NOMEM 0x3 #define BD_NOBIOS 0x4 #define BD_NOFEP 0x5 #define BD_FAILED 0x6 #define BD_BADKME 0x80 07070100000000000000000000000000000000000000010000000000000000000000000000000000000000000000000000000b00000000TRAILER!!!