# PaCkAgE DaTaStReAm DIGIras 1 18030 # end of header 070701000d2ae1000081a40000023d00000064000000013d32bb6d000000bb000000200000000700000000000000000000001000000003DIGIras/pkginfoPKG=DIGIras NAME=Digi Int'l Remote Access Driver ARCH=sparc VERSION=G CATEGORY=system,utilities CLASSES=none build VENDOR=Digi International, Inc HOTLINE=(952) 912-3444 PSTAMP= BASEDIR=/ 070701000d2ae0000081a40000023d00000064000000013d32bb6d00005d8a000000200000000700000000000000000000000f00000003DIGIras/pkgmap: 1 18030 1 d none /etc ? ? ? 1 d none /etc/digi 0775 root sys 1 d none /etc/digi/text 0775 root sys 1 d none /etc/digi/text/info 0775 root sys 1 f none /etc/digi/text/info/dpa_info1 0444 root sys 2145 31931 952633361 1 f none /etc/digi/text/info/dpa_info2 0444 root sys 603 51336 760881957 1 f none /etc/digi/text/info/dpa_info3 0444 root sys 324 29920 760881957 1 f none /etc/digi/text/info/dpa_info4 0444 root sys 4754 28971 955035168 1 f none /etc/digi/text/info/dpa_info5 0444 root sys 2657 2240 955035169 1 f none /etc/digi/text/info/dpa_info6 0444 root sys 594 45993 844454011 1 f none /etc/digi/text/info/dpa_info7 0444 root sys 7120 2828 952633367 1 f none /etc/digi/text/info/dpa_info8 0444 root sys 617 54381 844453713 1 f none /etc/digi/text/info/dpa_info9 0444 root sys 3625 32836 852048311 1 d none /etc/rc2.d ? ? ? 1 s none /etc/rc2.d/S90DIGIras=/opt/DIGIras/firmware/S90DIGIras 1 d none /opt ? ? ? 1 d none /opt/DIGIras ? ? ? 1 s none /opt/DIGIras/README=release_notes 1 d none /opt/DIGIras/bin ? ? ? 1 f none /opt/DIGIras/bin/dgdxb_board_to_instance 0750 root sys 7860 48850 1026499863 1 f none /opt/DIGIras/bin/digiras_info 0750 root sys 11772 61358 1026499812 1 f none /opt/DIGIras/bin/digiras_reset 0750 root sys 12456 38408 1026499813 1 f none /opt/DIGIras/bin/digiras_update_devlinks 0755 root sys 13668 29539 1026499802 1 f none /opt/DIGIras/bin/ditty 0750 root sys 30172 2744 1026499821 1 f none /opt/DIGIras/bin/dm_admin 0750 root sys 79248 59285 1026499860 1 f none /opt/DIGIras/bin/dm_gui 0750 root sys 592 47390 968876716 1 f none /opt/DIGIras/bin/dm_portreg 0750 root sys 38128 26786 1026499862 1 f none /opt/DIGIras/bin/dm_trace 0750 root sys 40140 45652 1026499818 1 f none /opt/DIGIras/bin/dpa 0750 root sys 194088 39853 1026499852 1 f none /opt/DIGIras/bin/pamagent 0750 root sys 84604 11428 1026499831 1 f none /opt/DIGIras/bin/ras_config 0750 root sys 81928 11471 1026499809 1 f none /opt/DIGIras/dgasy64 0755 root sys 176096 31848 1026499912 1 f none /opt/DIGIras/dgdxb64 0755 root sys 251776 6835 1026499903 1 d none /opt/DIGIras/firmware 0755 root sys 1 f none /opt/DIGIras/firmware/S90DIGIras 0755 root sys 2216 42961 984682152 1 f none /opt/DIGIras/firmware/dg_dwnldr 0755 root sys 11020 24628 1026499801 1 f none /opt/DIGIras/firmware/hou2fep.bin 0444 root sys 1941504 17241 1026499775 1 f none /opt/DIGIras/firmware/rap2fep.bin 0444 root sys 192512 10760 1026499775 1 f none /opt/DIGIras/firmware/rappost.bin 0444 root sys 81920 22656 1026499775 1 d none /opt/DIGIras/gui ? ? ? 1 f none /opt/DIGIras/gui/chart.gif 0755 root sys 540 63806 949249320 1 f none /opt/DIGIras/gui/dm_config.tcl 0644 root sys 63977 8961 1026734956 1 f none /opt/DIGIras/gui/dm_gui.tcl 0755 root sys 3570 41796 1026499883 1 f none /opt/DIGIras/gui/dm_help.tcl 0755 root sys 22236 1545 985385768 1 f none /opt/DIGIras/gui/dm_misc.tcl 0755 root sys 25425 42396 985385770 1 f none /opt/DIGIras/gui/dm_osdep.tcl 0755 root sys 2685 10330 1026499883 1 f none /opt/DIGIras/gui/dm_status.tcl 0755 root sys 69573 14610 985385774 1 f none /opt/DIGIras/gui/help-book.gif 0755 root sys 597 2781 949249323 1 f none /opt/DIGIras/gui/help.gif 0755 root sys 30041 24101 949249324 1 f none /opt/DIGIras/gui/houston-board.gif 0755 root sys 512 63568 949249325 1 f none /opt/DIGIras/gui/pkgIndex.tcl 0644 root sys 3580 30410 1026499883 1 d none /opt/DIGIras/gui/tcl 0755 root sys 1 d none /opt/DIGIras/gui/tcl/bin 0755 root sys 1 f none /opt/DIGIras/gui/tcl/bin/tixwish4.1.8.0 0755 root sys 70172 19896 971287868 1 d none /opt/DIGIras/gui/tcl/lib 0755 root sys 1 f none /opt/DIGIras/gui/tcl/lib/libtcl8.0.so 0644 root sys 728784 502 971288020 1 f none /opt/DIGIras/gui/tcl/lib/libtix4.1.8.0.so 0644 root sys 489768 34145 971288023 1 f none /opt/DIGIras/gui/tcl/lib/libtk8.0.so 0644 root sys 1005856 51748 971288025 1 d none /opt/DIGIras/gui/tcl/lib/tcl8.0 0755 root sys 1 f none /opt/DIGIras/gui/tcl/lib/tcl8.0/history.tcl 0644 root sys 8987 12355 971288253 1 f none /opt/DIGIras/gui/tcl/lib/tcl8.0/init.tcl 0644 root sys 47400 56879 971288253 1 f none /opt/DIGIras/gui/tcl/lib/tcl8.0/ldAout.tcl 0644 root sys 6664 26076 971288254 1 f none /opt/DIGIras/gui/tcl/lib/tcl8.0/parray.tcl 0644 root sys 880 5525 971288254 1 f none /opt/DIGIras/gui/tcl/lib/tcl8.0/safe.tcl 0644 root sys 26754 38868 971288255 1 f none /opt/DIGIras/gui/tcl/lib/tcl8.0/tclAppInit.c 0644 root sys 3867 37915 971288256 1 f none /opt/DIGIras/gui/tcl/lib/tcl8.0/tclIndex 0644 root sys 1485 5452 971288257 1 f none /opt/DIGIras/gui/tcl/lib/tcl8.0/word.tcl 0644 root sys 4468 62401 971288255 1 f none /opt/DIGIras/gui/tcl/lib/tclsh8.0 0755 root sys 68680 3168 971288074 1 d none /opt/DIGIras/gui/tcl/lib/tix4.1 0755 root sys 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/Balloon.tcl 0644 root sys 12347 43879 971288340 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/BtnBox.tcl 0644 root sys 2497 59128 971288340 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/CObjView.tcl 0644 root sys 7650 56870 971288341 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/ChkList.tcl 0644 root sys 5084 65420 971288341 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/ComboBox.tcl 0644 root sys 34182 39845 971288342 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/Compat.tcl 0644 root sys 827 4915 971288342 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/Console.tcl 0644 root sys 12262 18961 971288343 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/Control.tcl 0644 root sys 11917 28491 971288343 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/DefSchm.tcl 0644 root sys 2638 16479 971288344 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/DialogS.tcl 0644 root sys 4094 2686 971288344 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/DirBox.tcl 0644 root sys 5511 40500 971288344 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/DirDlg.tcl 0644 root sys 2027 35190 971288345 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/DirList.tcl 0644 root sys 7328 53064 971288345 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/DirTree.tcl 0644 root sys 9533 32801 971288346 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/DragDrop.tcl 0644 root sys 3817 20717 971288346 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/DtlList.tcl 0644 root sys 827 261 971288347 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/EFileBox.tcl 0644 root sys 11284 54410 971288347 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/EFileDlg.tcl 0644 root sys 1403 51716 971288347 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/Event.tcl 0644 root sys 5566 3170 971288348 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/FileBox.tcl 0644 root sys 14502 31580 971288348 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/FileCbx.tcl 0644 root sys 2191 50766 971288349 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/FileCmpt.tcl 0644 root sys 886 8796 971288349 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/FileDlg.tcl 0644 root sys 2005 35587 971288349 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/FileEnt.tcl 0644 root sys 6022 16789 971288350 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/FileUtil.tcl 0644 root sys 1507 46512 971288350 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/FloatEnt.tcl 0644 root sys 2979 26329 971288351 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/Grid.tcl 0644 root sys 21194 30145 971288352 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/HList.tcl 0644 root sys 15928 15294 971288352 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/HListDD.tcl 0644 root sys 4320 59845 971288353 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/IconView.tcl 0644 root sys 6056 8836 971288353 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/Init.tcl 0644 root sys 4253 25484 971288354 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/LabEntry.tcl 0644 root sys 2084 32698 971288354 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/LabFrame.tcl 0644 root sys 1071 15432 971288355 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/LabWidg.tcl 0644 root sys 3774 38269 971288355 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/ListNBk.tcl 0644 root sys 3420 11494 971288356 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/Meter.tcl 0644 root sys 2815 20057 971288356 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/MultView.tcl 0644 root sys 3523 63809 971288357 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/NoteBook.tcl 0644 root sys 5923 54060 971288357 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/OldUtil.tcl 0644 root sys 5507 15976 971288357 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/OptMenu.tcl 0644 root sys 9209 7821 971288358 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/PanedWin.tcl 0644 root sys 27353 42471 971288358 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/PopMenu.tcl 0644 root sys 4824 57518 971288359 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/Primitiv.tcl 0644 root sys 10263 11000 971288360 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/ResizeH.tcl 0644 root sys 12856 21841 971288360 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/SGrid.tcl 0644 root sys 5549 17961 971288361 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/SHList.tcl 0644 root sys 3849 37464 971288361 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/SListBox.tcl 0644 root sys 7132 44956 971288361 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/STList.tcl 0644 root sys 2371 44218 971288362 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/SText.tcl 0644 root sys 3261 51910 971288362 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/SWidget.tcl 0644 root sys 10213 13996 971288363 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/SWindow.tcl 0644 root sys 6831 23018 971288363 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/Select.tcl 0644 root sys 7022 20613 971288364 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/Shell.tcl 0644 root sys 886 1688 971288364 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/SimpDlg.tcl 0644 root sys 982 14944 971288364 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/StackWin.tcl 0644 root sys 1810 14521 971288365 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/StatBar.tcl 0644 root sys 1164 13717 971288365 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/StdBBox.tcl 0644 root sys 1481 53236 971288366 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/StdShell.tcl 0644 root sys 997 17925 971288366 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/TList.tcl 0644 root sys 18646 20749 971288366 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/Tix.tcl 0644 root sys 12067 41014 971288367 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/Tree.tcl 0644 root sys 4142 44336 971288368 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/UnixFile.tcl 0644 root sys 7730 23333 971288368 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/Utils.tcl 0644 root sys 11345 59497 971288369 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/VResize.tcl 0644 root sys 4835 42323 971288369 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/VStack.tcl 0644 root sys 9567 22888 971288370 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/VTree.tcl 0644 root sys 4453 22761 971288370 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/Variable.tcl 0644 root sys 2383 62964 971288371 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/Verify.tcl 0644 root sys 434 36211 971288371 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/Version.tcl 0644 root sys 375 31445 971288371 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/WInfo.tcl 0644 root sys 792 64259 971288372 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/WinFile.tcl 0644 root sys 13883 49849 971288372 1 d none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps 0755 root sys 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/act_fold.gif 0644 root sys 90 7752 971289172 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/act_fold.xbm 0644 root sys 221 16272 971289111 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/act_fold.xpm 0644 root sys 436 27648 971289122 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/balarrow.xbm 0644 root sys 123 9938 971289111 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/cbxarrow.xbm 0644 root sys 263 18159 971289111 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/ck_def.xbm 0644 root sys 254 17445 971289112 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/ck_off.xbm 0644 root sys 254 17411 971289112 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/ck_on.xbm 0644 root sys 251 17340 971289113 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/cross.xbm 0644 root sys 254 17374 971289113 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/decr.xbm 0644 root sys 99 8020 971289113 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/drop.xbm 0644 root sys 326 23157 971289114 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/file.gif 0644 root sys 76 5586 971289173 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/file.xbm 0644 root sys 233 15965 971289114 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/file.xpm 0644 root sys 298 17804 971289122 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/folder.gif 0644 root sys 79 6333 971289173 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/folder.xbm 0644 root sys 215 15301 971289114 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/folder.xpm 0644 root sys 418 26381 971289123 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/harddisk.xbm 0644 root sys 896 56585 971289115 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/hourglas.mask 0644 root sys 969 63368 971289127 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/hourglas.xbm 0644 root sys 940 64196 971289115 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/incr.xbm 0644 root sys 99 8062 971289116 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/info.gif 0644 root sys 159 16906 971289173 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/info.xpm 0644 root sys 1258 12598 971289123 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/maximize.xbm 0644 root sys 284 19832 971289116 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/minimize.xbm 0644 root sys 284 19351 971289116 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/minus.gif 0644 root sys 57 3548 971289174 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/minus.xbm 0644 root sys 198 14293 971289117 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/minus.xpm 0644 root sys 201 10075 971289124 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/minusarm.gif 0644 root sys 59 4091 971289174 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/minusarm.xbm 0644 root sys 207 15427 971289117 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/minusarm.xpm 0644 root sys 220 11649 971289124 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/mktransgif.tcl 0644 root sys 176 14134 971289127 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/network.xbm 0644 root sys 893 56055 971289118 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/no_entry.gif 0644 root sys 176 19497 971289174 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/no_entry.xpm 0644 root sys 1274 19404 971289124 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/openfile.xbm 0644 root sys 221 16344 971289118 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/openfold.gif 0644 root sys 84 6491 971289175 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/openfold.xbm 0644 root sys 221 16109 971289118 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/openfold.xpm 0644 root sys 418 26410 971289125 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/plus.gif 0644 root sys 58 3498 971289175 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/plus.xbm 0644 root sys 195 13985 971289119 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/plus.xpm 0644 root sys 200 9915 971289125 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/plusarm.gif 0644 root sys 60 3814 971289175 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/plusarm.xbm 0644 root sys 204 15111 971289119 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/plusarm.xpm 0644 root sys 212 11057 971289125 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/resize1.xbm 0644 root sys 305 22122 971289120 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/resize2.xbm 0644 root sys 305 22127 971289120 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/restore.xbm 0644 root sys 281 19801 971289120 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/srcfile.gif 0644 root sys 79 5595 971289176 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/srcfile.xbm 0644 root sys 242 17191 971289121 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/srcfile.xpm 0644 root sys 294 17317 971289126 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/system.xbm 0644 root sys 278 19110 971289121 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/textfile.gif 0644 root sys 79 5957 971289176 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/textfile.xbm 0644 root sys 245 17654 971289121 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/textfile.xpm 0644 root sys 302 17543 971289126 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/tick.xbm 0644 root sys 251 16711 971289122 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/warning.gif 0644 root sys 180 18550 971289176 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/warning.xpm 0644 root sys 1262 12631 971289127 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/fs.tcl 0644 root sys 11080 31863 971288373 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pkgIndex.tcl 0644 root sys 135 11041 971288373 1 d none /opt/DIGIras/gui/tcl/lib/tix4.1/pref 0755 root sys 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pref/12Point.fs 0644 root sys 468 35544 971288448 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pref/12Point.fsc 0644 root sys 1872 28849 971288449 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pref/14Point.fs 0644 root sys 434 33069 971288448 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pref/14Point.fsc 0644 root sys 1839 26388 971288450 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pref/Bisque.cs 0644 root sys 960 12474 971288451 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pref/Bisque.csc 0644 root sys 22450 16281 971288453 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pref/Blue.cs 0644 root sys 979 13014 971288451 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pref/Blue.csc 0644 root sys 22465 16371 971288453 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pref/Gray.cs 0644 root sys 979 14167 971288451 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pref/Gray.csc 0644 root sys 22465 17546 971288454 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pref/Makefile 0644 root sys 754 58711 971288456 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pref/Old12Pt.fs 0644 root sys 476 36220 971288448 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pref/Old14Pt.fs 0644 root sys 434 33066 971288449 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pref/SGIGray.cs 0644 root sys 957 12485 971288452 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pref/SGIGray.csc 0644 root sys 22447 16298 971288455 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pref/TK.cs 0644 root sys 960 10903 971288452 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pref/TK.csc 0644 root sys 1958 26617 971288455 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pref/TK.fs 0644 root sys 446 35070 971288449 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pref/TK.fsc 0644 root sys 508 40587 971288450 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pref/TixGray.cs 0644 root sys 957 12223 971288452 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pref/TixGray.csc 0644 root sys 22449 16220 971288456 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pref/tixmkpref 0644 root sys 9642 62332 971288457 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/tclIndex 0644 root sys 31294 53751 971288374 1 d none /opt/DIGIras/gui/tcl/lib/tk8.0 0755 root sys 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/bgerror.tcl 0644 root sys 3483 23687 971288840 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/button.tcl 0644 root sys 11063 59580 971288840 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/clrpick.tcl 0644 root sys 19889 47065 971288841 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/comdlg.tcl 0644 root sys 7538 27919 971288842 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/console.tcl 0644 root sys 12146 12490 971288842 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/dialog.tcl 0644 root sys 5437 53391 971288843 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/entry.tcl 0644 root sys 15466 42415 971288843 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/focus.tcl 0644 root sys 4902 7443 971288843 1 d none /opt/DIGIras/gui/tcl/lib/tk8.0/images 0755 root sys 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/images/logo100.gif 0644 root sys 2341 13514 971288978 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/images/logo64.gif 0644 root sys 1670 61083 971288978 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/images/logoLarge.gif 0644 root sys 11000 38754 971288979 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/images/logoMed.gif 0644 root sys 3889 4936 971288979 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/images/pwrdLogo100.gif 0644 root sys 4147 39445 971288979 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/images/pwrdLogo150.gif 0644 root sys 6809 42674 971288980 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/images/pwrdLogo175.gif 0644 root sys 7964 37225 971288980 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/images/pwrdLogo200.gif 0644 root sys 8964 33342 971288981 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/images/pwrdLogo75.gif 0644 root sys 3189 62282 971288982 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/listbox.tcl 0644 root sys 12008 9431 971288844 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/menu.tcl 0644 root sys 34017 4453 971288844 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/msgbox.tcl 0644 root sys 6993 33984 971288845 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/obsolete.tcl 0644 root sys 801 3240 971288846 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/optMenu.tcl 0644 root sys 1657 9272 971288846 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/palette.tcl 0644 root sys 7352 22066 971288847 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/prolog.ps 0644 root sys 9567 28624 971288891 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/safetk.tcl 0644 root sys 6267 57639 971288847 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/scale.tcl 0644 root sys 6811 31570 971288847 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/scrlbar.tcl 0644 root sys 11613 45864 971288848 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/tclIndex 0644 root sys 18155 64757 971288851 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/tearoff.tcl 0644 root sys 4050 371 971288848 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/text.tcl 0644 root sys 26628 48640 971288849 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/tk.tcl 0644 root sys 5694 3542 971288849 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/tkAppInit.c 0644 root sys 3228 50586 971288852 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/tkfbox.tcl 0644 root sys 37610 56983 971288850 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/xmfbox.tcl 0644 root sys 16696 36700 971288851 1 f none /opt/DIGIras/gui/tcldgdm.so 0755 root sys 1562396 29581 1026499882 1 f none /opt/DIGIras/gui/tree-adapter.gif 0755 root sys 131 14058 949249325 1 f none /opt/DIGIras/gui/tree-chan.gif 0755 root sys 96 7596 949249325 1 f none /opt/DIGIras/gui/tree-port.gif 0755 root sys 109 9226 949249326 1 f none /opt/DIGIras/release_notes 0644 root other 16581 35962 1026487650 1 d none /usr ? ? ? 1 d none /usr/sbin ? ? ? 1 s none /usr/sbin/digiras_info=/opt/DIGIras/bin/digiras_info 1 s none /usr/sbin/digiras_reset=/opt/DIGIras/bin/digiras_reset 1 s none /usr/sbin/ditty=/opt/DIGIras/bin/ditty 1 s none /usr/sbin/dm_admin=/opt/DIGIras/bin/dm_admin 1 s none /usr/sbin/dm_gui=/opt/DIGIras/bin/dm_gui 1 s none /usr/sbin/dm_portreg=/opt/DIGIras/bin/dm_portreg 1 s none /usr/sbin/dm_trace=/opt/DIGIras/bin/dm_trace 1 s none /usr/sbin/dpa=/opt/DIGIras/bin/dpa 1 d none /usr/share ? ? ? 1 d none /usr/share/man ? ? ? 1 d none /usr/share/man/man1 ? ? ? 1 f none /usr/share/man/man1/DIGIras.1 0755 root sys 12614 45727 1026496190 1 f none /usr/share/man/man1/digiras.1 0755 root sys 12614 45727 1026496190 1 f none /usr/share/man/man1/digiras_reset.1 0755 root sys 2114 54711 982002250 1 f none /usr/share/man/man1/ditty.1 0755 root other 7722 627 982002651 1 f none /usr/share/man/man1/dm_admin.1 0755 root other 22798 45418 1026734956 1 f none /usr/share/man/man1/dm_gui.1 0755 root other 1160 36578 949249322 1 f none /usr/share/man/man1/dm_portreg.1 0755 root other 5140 53818 1026499862 1 f none /usr/share/man/man1/dm_trace.1 0755 root other 10412 30228 1026499818 1 f none /usr/share/man/man1/dpa.1 0755 root other 1096 27039 967643263 1 i copyright 70 5750 982002508 1 d none kernel ? ? ? 1 d none kernel/drv ? ? ? 1 f none kernel/drv/dgasy 0755 root sys 115836 1528 1026499800 1 f none kernel/drv/dgasy.conf 0644 root sys 96 7718 916815947 1 f none kernel/drv/dgdxb 0755 root sys 164572 21513 1026499792 1 i pkginfo 187 14737 1026734957 1 i postinstall 6700 19682 1026494377 1 i postremove 1442 36475 953061501 1 i preremove 1366 42539 972954239 1 i space 10 630 916815623 07070100000000000000000000000000000000000000010000000000000000000000000000000000000000000000000000000b00000000TRAILER!!!070701000d2ae1000081a40000023d00000064000000013d32bb6d000000bb000000200000000700000000000000000000000800000003pkginfoPKG=DIGIras NAME=Digi Int'l Remote Access Driver ARCH=sparc VERSION=G CATEGORY=system,utilities CLASSES=none build VENDOR=Digi International, Inc HOTLINE=(952) 912-3444 PSTAMP= BASEDIR=/ 070701000d2ae0000081a40000023d00000064000000013d32bb6d00005d8a000000200000000700000000000000000000000700000003pkgmap: 1 18030 1 d none /etc ? ? ? 1 d none /etc/digi 0775 root sys 1 d none /etc/digi/text 0775 root sys 1 d none /etc/digi/text/info 0775 root sys 1 f none /etc/digi/text/info/dpa_info1 0444 root sys 2145 31931 952633361 1 f none /etc/digi/text/info/dpa_info2 0444 root sys 603 51336 760881957 1 f none /etc/digi/text/info/dpa_info3 0444 root sys 324 29920 760881957 1 f none /etc/digi/text/info/dpa_info4 0444 root sys 4754 28971 955035168 1 f none /etc/digi/text/info/dpa_info5 0444 root sys 2657 2240 955035169 1 f none /etc/digi/text/info/dpa_info6 0444 root sys 594 45993 844454011 1 f none /etc/digi/text/info/dpa_info7 0444 root sys 7120 2828 952633367 1 f none /etc/digi/text/info/dpa_info8 0444 root sys 617 54381 844453713 1 f none /etc/digi/text/info/dpa_info9 0444 root sys 3625 32836 852048311 1 d none /etc/rc2.d ? ? ? 1 s none /etc/rc2.d/S90DIGIras=/opt/DIGIras/firmware/S90DIGIras 1 d none /opt ? ? ? 1 d none /opt/DIGIras ? ? ? 1 s none /opt/DIGIras/README=release_notes 1 d none /opt/DIGIras/bin ? ? ? 1 f none /opt/DIGIras/bin/dgdxb_board_to_instance 0750 root sys 7860 48850 1026499863 1 f none /opt/DIGIras/bin/digiras_info 0750 root sys 11772 61358 1026499812 1 f none /opt/DIGIras/bin/digiras_reset 0750 root sys 12456 38408 1026499813 1 f none /opt/DIGIras/bin/digiras_update_devlinks 0755 root sys 13668 29539 1026499802 1 f none /opt/DIGIras/bin/ditty 0750 root sys 30172 2744 1026499821 1 f none /opt/DIGIras/bin/dm_admin 0750 root sys 79248 59285 1026499860 1 f none /opt/DIGIras/bin/dm_gui 0750 root sys 592 47390 968876716 1 f none /opt/DIGIras/bin/dm_portreg 0750 root sys 38128 26786 1026499862 1 f none /opt/DIGIras/bin/dm_trace 0750 root sys 40140 45652 1026499818 1 f none /opt/DIGIras/bin/dpa 0750 root sys 194088 39853 1026499852 1 f none /opt/DIGIras/bin/pamagent 0750 root sys 84604 11428 1026499831 1 f none /opt/DIGIras/bin/ras_config 0750 root sys 81928 11471 1026499809 1 f none /opt/DIGIras/dgasy64 0755 root sys 176096 31848 1026499912 1 f none /opt/DIGIras/dgdxb64 0755 root sys 251776 6835 1026499903 1 d none /opt/DIGIras/firmware 0755 root sys 1 f none /opt/DIGIras/firmware/S90DIGIras 0755 root sys 2216 42961 984682152 1 f none /opt/DIGIras/firmware/dg_dwnldr 0755 root sys 11020 24628 1026499801 1 f none /opt/DIGIras/firmware/hou2fep.bin 0444 root sys 1941504 17241 1026499775 1 f none /opt/DIGIras/firmware/rap2fep.bin 0444 root sys 192512 10760 1026499775 1 f none /opt/DIGIras/firmware/rappost.bin 0444 root sys 81920 22656 1026499775 1 d none /opt/DIGIras/gui ? ? ? 1 f none /opt/DIGIras/gui/chart.gif 0755 root sys 540 63806 949249320 1 f none /opt/DIGIras/gui/dm_config.tcl 0644 root sys 63977 8961 1026734956 1 f none /opt/DIGIras/gui/dm_gui.tcl 0755 root sys 3570 41796 1026499883 1 f none /opt/DIGIras/gui/dm_help.tcl 0755 root sys 22236 1545 985385768 1 f none /opt/DIGIras/gui/dm_misc.tcl 0755 root sys 25425 42396 985385770 1 f none /opt/DIGIras/gui/dm_osdep.tcl 0755 root sys 2685 10330 1026499883 1 f none /opt/DIGIras/gui/dm_status.tcl 0755 root sys 69573 14610 985385774 1 f none /opt/DIGIras/gui/help-book.gif 0755 root sys 597 2781 949249323 1 f none /opt/DIGIras/gui/help.gif 0755 root sys 30041 24101 949249324 1 f none /opt/DIGIras/gui/houston-board.gif 0755 root sys 512 63568 949249325 1 f none /opt/DIGIras/gui/pkgIndex.tcl 0644 root sys 3580 30410 1026499883 1 d none /opt/DIGIras/gui/tcl 0755 root sys 1 d none /opt/DIGIras/gui/tcl/bin 0755 root sys 1 f none /opt/DIGIras/gui/tcl/bin/tixwish4.1.8.0 0755 root sys 70172 19896 971287868 1 d none /opt/DIGIras/gui/tcl/lib 0755 root sys 1 f none /opt/DIGIras/gui/tcl/lib/libtcl8.0.so 0644 root sys 728784 502 971288020 1 f none /opt/DIGIras/gui/tcl/lib/libtix4.1.8.0.so 0644 root sys 489768 34145 971288023 1 f none /opt/DIGIras/gui/tcl/lib/libtk8.0.so 0644 root sys 1005856 51748 971288025 1 d none /opt/DIGIras/gui/tcl/lib/tcl8.0 0755 root sys 1 f none /opt/DIGIras/gui/tcl/lib/tcl8.0/history.tcl 0644 root sys 8987 12355 971288253 1 f none /opt/DIGIras/gui/tcl/lib/tcl8.0/init.tcl 0644 root sys 47400 56879 971288253 1 f none /opt/DIGIras/gui/tcl/lib/tcl8.0/ldAout.tcl 0644 root sys 6664 26076 971288254 1 f none /opt/DIGIras/gui/tcl/lib/tcl8.0/parray.tcl 0644 root sys 880 5525 971288254 1 f none /opt/DIGIras/gui/tcl/lib/tcl8.0/safe.tcl 0644 root sys 26754 38868 971288255 1 f none /opt/DIGIras/gui/tcl/lib/tcl8.0/tclAppInit.c 0644 root sys 3867 37915 971288256 1 f none /opt/DIGIras/gui/tcl/lib/tcl8.0/tclIndex 0644 root sys 1485 5452 971288257 1 f none /opt/DIGIras/gui/tcl/lib/tcl8.0/word.tcl 0644 root sys 4468 62401 971288255 1 f none /opt/DIGIras/gui/tcl/lib/tclsh8.0 0755 root sys 68680 3168 971288074 1 d none /opt/DIGIras/gui/tcl/lib/tix4.1 0755 root sys 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/Balloon.tcl 0644 root sys 12347 43879 971288340 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/BtnBox.tcl 0644 root sys 2497 59128 971288340 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/CObjView.tcl 0644 root sys 7650 56870 971288341 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/ChkList.tcl 0644 root sys 5084 65420 971288341 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/ComboBox.tcl 0644 root sys 34182 39845 971288342 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/Compat.tcl 0644 root sys 827 4915 971288342 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/Console.tcl 0644 root sys 12262 18961 971288343 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/Control.tcl 0644 root sys 11917 28491 971288343 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/DefSchm.tcl 0644 root sys 2638 16479 971288344 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/DialogS.tcl 0644 root sys 4094 2686 971288344 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/DirBox.tcl 0644 root sys 5511 40500 971288344 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/DirDlg.tcl 0644 root sys 2027 35190 971288345 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/DirList.tcl 0644 root sys 7328 53064 971288345 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/DirTree.tcl 0644 root sys 9533 32801 971288346 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/DragDrop.tcl 0644 root sys 3817 20717 971288346 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/DtlList.tcl 0644 root sys 827 261 971288347 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/EFileBox.tcl 0644 root sys 11284 54410 971288347 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/EFileDlg.tcl 0644 root sys 1403 51716 971288347 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/Event.tcl 0644 root sys 5566 3170 971288348 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/FileBox.tcl 0644 root sys 14502 31580 971288348 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/FileCbx.tcl 0644 root sys 2191 50766 971288349 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/FileCmpt.tcl 0644 root sys 886 8796 971288349 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/FileDlg.tcl 0644 root sys 2005 35587 971288349 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/FileEnt.tcl 0644 root sys 6022 16789 971288350 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/FileUtil.tcl 0644 root sys 1507 46512 971288350 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/FloatEnt.tcl 0644 root sys 2979 26329 971288351 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/Grid.tcl 0644 root sys 21194 30145 971288352 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/HList.tcl 0644 root sys 15928 15294 971288352 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/HListDD.tcl 0644 root sys 4320 59845 971288353 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/IconView.tcl 0644 root sys 6056 8836 971288353 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/Init.tcl 0644 root sys 4253 25484 971288354 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/LabEntry.tcl 0644 root sys 2084 32698 971288354 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/LabFrame.tcl 0644 root sys 1071 15432 971288355 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/LabWidg.tcl 0644 root sys 3774 38269 971288355 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/ListNBk.tcl 0644 root sys 3420 11494 971288356 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/Meter.tcl 0644 root sys 2815 20057 971288356 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/MultView.tcl 0644 root sys 3523 63809 971288357 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/NoteBook.tcl 0644 root sys 5923 54060 971288357 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/OldUtil.tcl 0644 root sys 5507 15976 971288357 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/OptMenu.tcl 0644 root sys 9209 7821 971288358 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/PanedWin.tcl 0644 root sys 27353 42471 971288358 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/PopMenu.tcl 0644 root sys 4824 57518 971288359 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/Primitiv.tcl 0644 root sys 10263 11000 971288360 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/ResizeH.tcl 0644 root sys 12856 21841 971288360 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/SGrid.tcl 0644 root sys 5549 17961 971288361 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/SHList.tcl 0644 root sys 3849 37464 971288361 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/SListBox.tcl 0644 root sys 7132 44956 971288361 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/STList.tcl 0644 root sys 2371 44218 971288362 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/SText.tcl 0644 root sys 3261 51910 971288362 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/SWidget.tcl 0644 root sys 10213 13996 971288363 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/SWindow.tcl 0644 root sys 6831 23018 971288363 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/Select.tcl 0644 root sys 7022 20613 971288364 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/Shell.tcl 0644 root sys 886 1688 971288364 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/SimpDlg.tcl 0644 root sys 982 14944 971288364 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/StackWin.tcl 0644 root sys 1810 14521 971288365 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/StatBar.tcl 0644 root sys 1164 13717 971288365 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/StdBBox.tcl 0644 root sys 1481 53236 971288366 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/StdShell.tcl 0644 root sys 997 17925 971288366 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/TList.tcl 0644 root sys 18646 20749 971288366 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/Tix.tcl 0644 root sys 12067 41014 971288367 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/Tree.tcl 0644 root sys 4142 44336 971288368 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/UnixFile.tcl 0644 root sys 7730 23333 971288368 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/Utils.tcl 0644 root sys 11345 59497 971288369 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/VResize.tcl 0644 root sys 4835 42323 971288369 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/VStack.tcl 0644 root sys 9567 22888 971288370 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/VTree.tcl 0644 root sys 4453 22761 971288370 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/Variable.tcl 0644 root sys 2383 62964 971288371 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/Verify.tcl 0644 root sys 434 36211 971288371 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/Version.tcl 0644 root sys 375 31445 971288371 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/WInfo.tcl 0644 root sys 792 64259 971288372 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/WinFile.tcl 0644 root sys 13883 49849 971288372 1 d none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps 0755 root sys 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/act_fold.gif 0644 root sys 90 7752 971289172 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/act_fold.xbm 0644 root sys 221 16272 971289111 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/act_fold.xpm 0644 root sys 436 27648 971289122 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/balarrow.xbm 0644 root sys 123 9938 971289111 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/cbxarrow.xbm 0644 root sys 263 18159 971289111 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/ck_def.xbm 0644 root sys 254 17445 971289112 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/ck_off.xbm 0644 root sys 254 17411 971289112 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/ck_on.xbm 0644 root sys 251 17340 971289113 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/cross.xbm 0644 root sys 254 17374 971289113 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/decr.xbm 0644 root sys 99 8020 971289113 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/drop.xbm 0644 root sys 326 23157 971289114 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/file.gif 0644 root sys 76 5586 971289173 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/file.xbm 0644 root sys 233 15965 971289114 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/file.xpm 0644 root sys 298 17804 971289122 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/folder.gif 0644 root sys 79 6333 971289173 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/folder.xbm 0644 root sys 215 15301 971289114 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/folder.xpm 0644 root sys 418 26381 971289123 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/harddisk.xbm 0644 root sys 896 56585 971289115 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/hourglas.mask 0644 root sys 969 63368 971289127 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/hourglas.xbm 0644 root sys 940 64196 971289115 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/incr.xbm 0644 root sys 99 8062 971289116 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/info.gif 0644 root sys 159 16906 971289173 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/info.xpm 0644 root sys 1258 12598 971289123 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/maximize.xbm 0644 root sys 284 19832 971289116 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/minimize.xbm 0644 root sys 284 19351 971289116 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/minus.gif 0644 root sys 57 3548 971289174 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/minus.xbm 0644 root sys 198 14293 971289117 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/minus.xpm 0644 root sys 201 10075 971289124 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/minusarm.gif 0644 root sys 59 4091 971289174 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/minusarm.xbm 0644 root sys 207 15427 971289117 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/minusarm.xpm 0644 root sys 220 11649 971289124 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/mktransgif.tcl 0644 root sys 176 14134 971289127 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/network.xbm 0644 root sys 893 56055 971289118 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/no_entry.gif 0644 root sys 176 19497 971289174 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/no_entry.xpm 0644 root sys 1274 19404 971289124 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/openfile.xbm 0644 root sys 221 16344 971289118 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/openfold.gif 0644 root sys 84 6491 971289175 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/openfold.xbm 0644 root sys 221 16109 971289118 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/openfold.xpm 0644 root sys 418 26410 971289125 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/plus.gif 0644 root sys 58 3498 971289175 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/plus.xbm 0644 root sys 195 13985 971289119 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/plus.xpm 0644 root sys 200 9915 971289125 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/plusarm.gif 0644 root sys 60 3814 971289175 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/plusarm.xbm 0644 root sys 204 15111 971289119 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/plusarm.xpm 0644 root sys 212 11057 971289125 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/resize1.xbm 0644 root sys 305 22122 971289120 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/resize2.xbm 0644 root sys 305 22127 971289120 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/restore.xbm 0644 root sys 281 19801 971289120 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/srcfile.gif 0644 root sys 79 5595 971289176 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/srcfile.xbm 0644 root sys 242 17191 971289121 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/srcfile.xpm 0644 root sys 294 17317 971289126 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/system.xbm 0644 root sys 278 19110 971289121 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/textfile.gif 0644 root sys 79 5957 971289176 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/textfile.xbm 0644 root sys 245 17654 971289121 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/textfile.xpm 0644 root sys 302 17543 971289126 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/tick.xbm 0644 root sys 251 16711 971289122 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/warning.gif 0644 root sys 180 18550 971289176 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/bitmaps/warning.xpm 0644 root sys 1262 12631 971289127 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/fs.tcl 0644 root sys 11080 31863 971288373 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pkgIndex.tcl 0644 root sys 135 11041 971288373 1 d none /opt/DIGIras/gui/tcl/lib/tix4.1/pref 0755 root sys 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pref/12Point.fs 0644 root sys 468 35544 971288448 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pref/12Point.fsc 0644 root sys 1872 28849 971288449 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pref/14Point.fs 0644 root sys 434 33069 971288448 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pref/14Point.fsc 0644 root sys 1839 26388 971288450 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pref/Bisque.cs 0644 root sys 960 12474 971288451 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pref/Bisque.csc 0644 root sys 22450 16281 971288453 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pref/Blue.cs 0644 root sys 979 13014 971288451 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pref/Blue.csc 0644 root sys 22465 16371 971288453 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pref/Gray.cs 0644 root sys 979 14167 971288451 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pref/Gray.csc 0644 root sys 22465 17546 971288454 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pref/Makefile 0644 root sys 754 58711 971288456 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pref/Old12Pt.fs 0644 root sys 476 36220 971288448 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pref/Old14Pt.fs 0644 root sys 434 33066 971288449 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pref/SGIGray.cs 0644 root sys 957 12485 971288452 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pref/SGIGray.csc 0644 root sys 22447 16298 971288455 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pref/TK.cs 0644 root sys 960 10903 971288452 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pref/TK.csc 0644 root sys 1958 26617 971288455 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pref/TK.fs 0644 root sys 446 35070 971288449 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pref/TK.fsc 0644 root sys 508 40587 971288450 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pref/TixGray.cs 0644 root sys 957 12223 971288452 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pref/TixGray.csc 0644 root sys 22449 16220 971288456 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/pref/tixmkpref 0644 root sys 9642 62332 971288457 1 f none /opt/DIGIras/gui/tcl/lib/tix4.1/tclIndex 0644 root sys 31294 53751 971288374 1 d none /opt/DIGIras/gui/tcl/lib/tk8.0 0755 root sys 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/bgerror.tcl 0644 root sys 3483 23687 971288840 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/button.tcl 0644 root sys 11063 59580 971288840 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/clrpick.tcl 0644 root sys 19889 47065 971288841 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/comdlg.tcl 0644 root sys 7538 27919 971288842 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/console.tcl 0644 root sys 12146 12490 971288842 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/dialog.tcl 0644 root sys 5437 53391 971288843 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/entry.tcl 0644 root sys 15466 42415 971288843 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/focus.tcl 0644 root sys 4902 7443 971288843 1 d none /opt/DIGIras/gui/tcl/lib/tk8.0/images 0755 root sys 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/images/logo100.gif 0644 root sys 2341 13514 971288978 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/images/logo64.gif 0644 root sys 1670 61083 971288978 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/images/logoLarge.gif 0644 root sys 11000 38754 971288979 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/images/logoMed.gif 0644 root sys 3889 4936 971288979 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/images/pwrdLogo100.gif 0644 root sys 4147 39445 971288979 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/images/pwrdLogo150.gif 0644 root sys 6809 42674 971288980 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/images/pwrdLogo175.gif 0644 root sys 7964 37225 971288980 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/images/pwrdLogo200.gif 0644 root sys 8964 33342 971288981 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/images/pwrdLogo75.gif 0644 root sys 3189 62282 971288982 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/listbox.tcl 0644 root sys 12008 9431 971288844 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/menu.tcl 0644 root sys 34017 4453 971288844 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/msgbox.tcl 0644 root sys 6993 33984 971288845 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/obsolete.tcl 0644 root sys 801 3240 971288846 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/optMenu.tcl 0644 root sys 1657 9272 971288846 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/palette.tcl 0644 root sys 7352 22066 971288847 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/prolog.ps 0644 root sys 9567 28624 971288891 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/safetk.tcl 0644 root sys 6267 57639 971288847 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/scale.tcl 0644 root sys 6811 31570 971288847 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/scrlbar.tcl 0644 root sys 11613 45864 971288848 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/tclIndex 0644 root sys 18155 64757 971288851 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/tearoff.tcl 0644 root sys 4050 371 971288848 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/text.tcl 0644 root sys 26628 48640 971288849 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/tk.tcl 0644 root sys 5694 3542 971288849 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/tkAppInit.c 0644 root sys 3228 50586 971288852 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/tkfbox.tcl 0644 root sys 37610 56983 971288850 1 f none /opt/DIGIras/gui/tcl/lib/tk8.0/xmfbox.tcl 0644 root sys 16696 36700 971288851 1 f none /opt/DIGIras/gui/tcldgdm.so 0755 root sys 1562396 29581 1026499882 1 f none /opt/DIGIras/gui/tree-adapter.gif 0755 root sys 131 14058 949249325 1 f none /opt/DIGIras/gui/tree-chan.gif 0755 root sys 96 7596 949249325 1 f none /opt/DIGIras/gui/tree-port.gif 0755 root sys 109 9226 949249326 1 f none /opt/DIGIras/release_notes 0644 root other 16581 35962 1026487650 1 d none /usr ? ? ? 1 d none /usr/sbin ? ? ? 1 s none /usr/sbin/digiras_info=/opt/DIGIras/bin/digiras_info 1 s none /usr/sbin/digiras_reset=/opt/DIGIras/bin/digiras_reset 1 s none /usr/sbin/ditty=/opt/DIGIras/bin/ditty 1 s none /usr/sbin/dm_admin=/opt/DIGIras/bin/dm_admin 1 s none /usr/sbin/dm_gui=/opt/DIGIras/bin/dm_gui 1 s none /usr/sbin/dm_portreg=/opt/DIGIras/bin/dm_portreg 1 s none /usr/sbin/dm_trace=/opt/DIGIras/bin/dm_trace 1 s none /usr/sbin/dpa=/opt/DIGIras/bin/dpa 1 d none /usr/share ? ? ? 1 d none /usr/share/man ? ? ? 1 d none /usr/share/man/man1 ? ? ? 1 f none /usr/share/man/man1/DIGIras.1 0755 root sys 12614 45727 1026496190 1 f none /usr/share/man/man1/digiras.1 0755 root sys 12614 45727 1026496190 1 f none /usr/share/man/man1/digiras_reset.1 0755 root sys 2114 54711 982002250 1 f none /usr/share/man/man1/ditty.1 0755 root other 7722 627 982002651 1 f none /usr/share/man/man1/dm_admin.1 0755 root other 22798 45418 1026734956 1 f none /usr/share/man/man1/dm_gui.1 0755 root other 1160 36578 949249322 1 f none /usr/share/man/man1/dm_portreg.1 0755 root other 5140 53818 1026499862 1 f none /usr/share/man/man1/dm_trace.1 0755 root other 10412 30228 1026499818 1 f none /usr/share/man/man1/dpa.1 0755 root other 1096 27039 967643263 1 i copyright 70 5750 982002508 1 d none kernel ? ? ? 1 d none kernel/drv ? ? ? 1 f none kernel/drv/dgasy 0755 root sys 115836 1528 1026499800 1 f none kernel/drv/dgasy.conf 0644 root sys 96 7718 916815947 1 f none kernel/drv/dgdxb 0755 root sys 164572 21513 1026499792 1 i pkginfo 187 14737 1026734957 1 i postinstall 6700 19682 1026494377 1 i postremove 1442 36475 953061501 1 i preremove 1366 42539 972954239 1 i space 10 630 916815623 07070100013b69000041ed0000023d00000064000000023d32bb7200000000000000200000000700000000000000000000000800000003install07070100013b6a000081a40000023d00000064000000013a882b4c00000046000000200000000700000000000000000000001200000003install/copyrightCopyright (c) 1999-2001 Digi International, Inc. All Rights Reserved 07070100013ba2000081a40000023d00000064000000013d2f0fa900001a2c000000200000000700000000000000000000001400000003install/postinstall#!/bin/sh #################################################################### # # Copyright (c) 1999-2000 Digi International Inc. All Rights Reserved. # This software contains proprietary and confidential information of Digi # International Inc. By accepting transfer of this copy, Recipient agrees # to retain this software in confidence, to prevent disclosure to others, # and to make no use of this software other than that for which it was # delivered. This is an unpublished copyrighted work of Digi International # Inc. Except as permitted by federal law, 17 USC 117, copying is strictly # prohibited. # # Post-Installation script for Digi Int'l RAS driver. # #################################################################### trap 'exit 3' 1 2 3 15 [ ! "$BASEDIR" ] && BASEDIR=/ PBASE=$BASEDIR [ "$BASEDIR" = "/" ] && PBASE= # This ID list enumerates all adapters that may someday be supported # See pci_ids.h for details ID_LIST="' \ \"pci114f,23\" \"pci114f,60\" \"pci114f,61\" \"pci114f,62\" \"pci114f,63\" \ \"pci114f,64\" \"pci114f,65\" \"pci114f,66\" \"pci114f,67\" \"pci114f,68\" \ \"pci114f,69\" \"pci114f,6a\" \"pci114f,6b\" \ \"pci114f,4e\" \"pci114f,4b\" \"pci114f,4c\" \"pci114f,4d\" \ \"pci114f,40\" \"pci114f,42\" \"pci114f,43\" \"pci114f,44\" \"pci114f,45\" '" # # Plop the 64-drivers into place if /kernel/drv/sparcv9 exists. # Otherwise, quietly delete them. # if [ -d /kernel/drv/sparcv9 ] then # echo "64-bit drivers copied into place." mv ${PBASE}/opt/DIGIras/dgdxb64 /kernel/drv/sparcv9/dgdxb mv ${PBASE}/opt/DIGIras/dgasy64 /kernel/drv/sparcv9/dgasy sync else rm -f ${PBASE}/opt/DIGIras/dgdxb64 ${PBASE}/opt/DIGIras/dgasy64 fi # # Function definitions #---------------------------------- # Install the physical-layer driver #---------------------------------- echo "\nInstalling the Digi RAS drivers. Please wait...\c" reboot_code=0 if [ "$BASEDIR" = "/" ] ; then [ -f /etc/rc2.d/S90DIGIras ] && /etc/rc2.d/S90DIGIras stop rem_drv dgasy >/dev/null 2>&1 if rem_drv dgdxb 2>&1 | grep "busy" >/dev/null ; then echo "\nCould not unload previous driver. Reboot required!" echo "Please wait...\c" reboot_code=20 else reboot_code=0 fi echo ".\c" sync echo $ID_LIST dgdxb | \ xargs >/tmp/null 2>&1 add_drv -m '* 0600 root sys' -i add_drv_stat=$? if [ ! $add_drv_stat -eq 0 ] ; then echo "\nCould not load new driver. Reboot required!" echo "Please wait...\c" reboot_code=20 fi sync add_drv -m '* 0666 root sys' dgasy >/dev/null 2>&1 sync echo ".\c" else rem_drv -b $BASEDIR dgasy >/dev/null 2>&1 rem_drv -b $BASEDIR dgdxb >/dev/null 2>&1 echo ".\c" sync echo $ID_LIST dgdxb | \ xargs >/tmp/null 2>&1 add_drv -m '* 0600 root sys' -b $BASEDIR -i add_drv_stat=$? sync add_drv -m '* 0666 root sys' -b $BASEDIR dgasy >/dev/null 2>&1 sync echo ".\c" echo "Software release notes are available in ${PBASE}/opt/DIGIras/release_notes." exit 0 fi asymajor=`awk '/dgasy / { print $NF }' /etc/name_to_major` dxbmajor=`awk '/dgdxb / { print $NF }' /etc/name_to_major` if [ ! "$asymajor" ] ; then echo "PROBLEM: The async driver (DGASY) was not successfully installed." exit 10 fi if [ ! "$dxbmajor" ] ; then echo "PROBLEM: The management driver (DGDXB) was not successfully installed." exit 10 fi ## # Make the device nodes. ## # Wipe out what was there. rm -rf /dev/DIGIras # Ready /etc/devlink.tab so that devlinks will do most of the work. cat /etc/devlink.tab | grep -vw pci114f | grep -vw dgasy > /etc/devlink.tmp mv /etc/devlink.tmp /etc/devlink.tab cat <>/etc/devlink.tab type=ddi_pseudo;name=pci114f,23 DIGIras/\M0 type=ddi_pseudo;name=pci114f,24 DIGIras/\M0 type=ddi_pseudo;name=pci114f,30 DIGIras/\M0 type=ddi_pseudo;name=pci114f,31 DIGIras/\M0 type=ddi_pseudo;name=pci114f,40 DIGIras/\M0 type=ddi_pseudo;name=pci114f,42 DIGIras/\M0 type=ddi_pseudo;name=pci114f,43 DIGIras/\M0 type=ddi_pseudo;name=pci114f,44 DIGIras/\M0 type=ddi_pseudo;name=pci114f,45 DIGIras/\M0 type=ddi_pseudo;name=pci114f,4b DIGIras/\M0 type=ddi_pseudo;name=pci114f,4c DIGIras/\M0 type=ddi_pseudo;name=pci114f,4d DIGIras/\M0 type=ddi_pseudo;name=pci114f,4e DIGIras/\M0 type=ddi_pseudo;name=pci114f,60 DIGIras/\M0 type=ddi_pseudo;name=pci114f,61 DIGIras/\M0 type=ddi_pseudo;name=pci114f,62 DIGIras/\M0 type=ddi_pseudo;name=pci114f,63 DIGIras/\M0 type=ddi_pseudo;name=pci114f,64 DIGIras/\M0 type=ddi_pseudo;name=pci114f,65 DIGIras/\M0 type=ddi_pseudo;name=pci114f,66 DIGIras/\M0 type=ddi_pseudo;name=pci114f,67 DIGIras/\M0 type=ddi_pseudo;name=pci114f,68 DIGIras/\M0 type=ddi_pseudo;name=pci114f,69 DIGIras/\M0 type=ddi_pseudo;name=pci114f,6a DIGIras/\M0 type=ddi_pseudo;name=pci114f,6b DIGIras/\M0 EOF #We create these with the digiras_update_device_links utility #type=ddi_pseudo;name=dgasy;minor2=tty DIGIras/\M1m #type=ddi_pseudo;name=dgasy;minor2=cu DIGIras/\M1s #type=ddi_pseudo;name=dgasy;minor2=lp DIGIras/\M0lp #type=ddi_pseudo;name=dgasy;minor2=tty term/\M1 #type=ddi_pseudo;name=dgasy;minor2=cu cua/\M1 #type=ddi_serial;name=dgasy term/\M1 #type=ddi_serial:dialout;name=dgasy cua/\M1 #We create these with the digiras_update_device_links utility # Make the /dev/term and /dev/cua nodes. #/usr/sbin/ports # Make the /dev/DIGIras nodes. /usr/sbin/devlinks # Make our serial nodes /opt/DIGIras/bin/digiras_update_devlinks oldstyle autopush -r -M $asymajor -m 0 2>/dev/null echo "dgasy -1 0 ldterm ttcompat" > /tmp/.digiras_push autopush -f /tmp/.digiras_push sed "/dgasy/d" /etc/iu.ap > /tmp/iu.ap.$$ echo " dgasy -1 0 ldterm ttcompat" >> /tmp/iu.ap.$$ mv /tmp/iu.ap.$$ /etc/iu.ap # get forceload stuff out of etc/system grep dgdxb /etc/system > /dev/null [ $? = 0 ] && { sed "/dgdxb/d" /etc/system > /etc/system.ed sed "/dgasy/d" /etc/system.ed > /etc/system sync rm -rf /etc/system.ed } ## # Make a version of the system file than can be helpful # when recovering from crashes on boot. ## cp /etc/system /etc/system_no_dg echo "" echo "exclude: dgasy" >> /etc/system_no_dg echo "exclude: dgdxb" >> /etc/system_no_dg ## # Edit the system file so we will be loaded at boot time. ## ed /etc/system </dev/null /forceload/ /^$/ i forceload: drv/dgdxb forceload: drv/dgasy . w /etc/system q ! sync ## # Prep the firmware-download daemon. ## /etc/rc2.d/S90DIGIras stop sync if [ $reboot_code -eq 0 ] ; then echo "\nLaunching the firmware downloader. Please wait...\c" fi /etc/rc2.d/S90DIGIras start echo ". done." echo "Each adapter is numbered according to the instance number assigned " echo "by the system in /etc/path_to_inst. " echo "\nSoftware release notes are available in ${PBASE}/opt/DIGIras/release_notes." # Give reboot message if necessary exit $reboot_code 07070100013ba4000081a40000023d000000640000000138ce907d000005a2000000200000000700000000000000000000001300000003install/postremove#!/bin/sh #################################################################### # # Copyright (c) 1999-2000 Digi International Inc. All Rights Reserved. # This software contains proprietary and confidential information of Digi # International Inc. By accepting transfer of this copy, Recipient agrees # to retain this software in confidence, to prevent disclosure to others, # and to make no use of this software other than that for which it was # delivered. This is an unpublished copyrighted work of Digi International # Inc. Except as permitted by federal law, 17 USC 117, copying is strictly # prohibited. # # Post-Removal script for Digi Int'l RAS driver. # #################################################################### # PKGINST=DIGI570 #----------------------------------------------------------- # Remove device files #----------------------------------------------------------- rm -rf /dev/DIGIras >/dev/null 2>&1 #----------------------------------------------------------- # Remove the 64-bit drivers #----------------------------------------------------------- rm -f /kernel/drv/sparcv9/dgdxb /kernel/drv/sparcv9/dgasy #----------------------------------------------------------- # Clean up /etc/devlink.tab #----------------------------------------------------------- cat /etc/devlink.tab | grep -vw pci114f | grep -vw dgasy > /etc/devlink.tmp mv /etc/devlink.tmp /etc/devlink.tab /usr/sbin/ports >/dev/null 2>&1 07070100013ba5000081a40000023d000000640000000139fe1a7f00000556000000200000000700000000000000000000001200000003install/preremove#!/bin/sh #################################################################### # # Copyright (c) 1999-2000 Digi International Inc. All Rights Reserved. # This software contains proprietary and confidential information of Digi # International Inc. By accepting transfer of this copy, Recipient agrees # to retain this software in confidence, to prevent disclosure to others, # and to make no use of this software other than that for which it was # delivered. This is an unpublished copyrighted work of Digi International # Inc. Except as permitted by federal law, 17 USC 117, copying is strictly # prohibited. # # Pre-Removal script for Digi Int'l RAS driver. # #################################################################### /etc/rc2.d/S90DIGIras stop >/dev/null 2>&1 # get forceload stuff out of etc/system grep dgdxb /etc/system > /dev/null [ $? = 0 ] && { sed "/dgdxb/d" /etc/system > /etc/system.ed sed "/dgasy/d" /etc/system.ed > /etc/system rm -rf /etc/system.ed } sed "/dgasy/d" /etc/iu.ap > /tmp/iu.ap.$$ mv /tmp/iu.ap.$$ /etc/iu.ap if [ "$BASEDIR" = "/" ] ; then rem_drv dgasy >/dev/null 2>&1 rem_drv dgdxb # rem_drv dgdxb >/dev/null 2>&1 else rem_drv -b $BASEDIR dgasy >/dev/null 2>&1 rem_drv -b $BASEDIR dgdxb >/dev/null 2>&1 fi #remove the serial device nodes we have created /opt/DIGIras/bin/digiras_update_devlinks remove exit 0 07070100013ba6000081a40000023d000000640000000136a57f070000000a000000200000000700000000000000000000000e00000003install/spacedata 10 1 070701000cc9d6000041ed0000023d00000064000000033d32bb7200000000000000200000000700000000000000000000000600000003reloc070701000cc9d7000041ed0000023d00000064000000033d32bb7200000000000000200000000700000000000000000000000d00000003reloc/kernel070701000d8be0000041ed0000023d00000064000000023d32bb7200000000000000200000000700000000000000000000001100000003reloc/kernel/drv070701000d8c20000081a40000023d00000064000000013d2f24d80001c47c000000200000000700000000000000000000001700000003reloc/kernel/drv/dgasyELF$4( l8, ( 㽠   @!`  @!``@@ +   `@`  @@ @`@`` @`f$` @`  @@ @`@`@` @`B " ``@   `@`@@ "`@`@& `&``&`@ @"@ " @`@` * ` `@`` @`Ā"aX@`aXa\  &aX`< &`<@@@  ` @` ` @@@&`܁  `@`` @@.aD&           @      #\ #\@@@@`@`@  `@`+` @6aHaH  `@`@@ @ @@`@`@  `0@`0` &`&` &`&`&`&a&a &a$&a (&a,&a@`@`@ ` @`̀@`@  `(@``(L ` `d@a@@ "`d@a@ "a``d@a@a`"@a`2a`2&a`&a`@`@ @ ` Y" ``@` @@&``<"```2``< &`< &aX"`@@`@`@  `@` @ @  㿠   @#   @# @ <2  "  @ < "  2    @  ܅0@ @ < <' <@  @ `@@ 㿠   @#Ѐ   @# @ <1@ )  @   @@ @ @   @  13 `" ` @`"    @ `  @ @@`" @ @&  '  '  1   <@   @@ @ @     @  㿠   @$   @$   !L@  $!L "$!L@$!L@ Ё 㿠   @$`  ,8 @$ aT@'aP 㿠    @$Ȁ  @$ɀ` 1 @$ "`@`@L @2 @ `@`@ @@ ` @`@L㿘  2   @$  2  @,8 @$ @ `   /`3/ @ ` @@ @/!X2 $!X` <$ <" @@ $  <  <`$ <@@@` @ ` @ @/ @$   @  "  㿠@  㿠 @`d2 `al2``&`@ &`@㿠 @aD2#`|` 2`|`+`@`&``d# "`<@ `<&`<`|@`(@" ```(`@&`@`&`@㿠   1 @& " ``@```l`W`d"'``aD" ``  @``|alalal`p ('`p "`d@`d`p '`p "`d@`d2 `"`d `d  `"` `@"` `"` `  `y    @/``  @`@@ @ 㿘@ 㿘@@  'Q1( ` @& '6`@ `8'@@` &` ( @ `<$`<`@ "``<2 `@@` '`& 1 @&@#@ & 㿠   @&@# 0Q M I 9      "&`0@0@@T@@@@@@@(@@ @! ` ``$ ͸ #L@ !@ $ @ 㿘  B@!@    @'&@ 0 0" <s#\ 2#`   ` d?!@ Z? " 0 2 * 6`, 6`.` &`6al6an6ap6ar.at.au.av.a~.a&`%@ `? @ aT?  @&``? @ `? @ `?Ĕ @ `?Д @ `?ܔ @ `? @ `(? @ `В @  \`#`  cL  @ \cL@`":%` @\ /   ```@ @ @!T@ @ @ @ @ @ @ (@ А@!$```(`\  ض@!%`B @0 ' @㿠 @   @& &2 &@㿠 @&``@`@㿘 '@`?@'!LcL" & ?' D@'  @@8`  @ '    @ '  @  @'  @@@ ` # ր` @   Ֆ @  Ԑ d@' Ԕ @ ԰ ' Ԁ?2!L!L!L"!L!L" !L@@  '@@@@@@ @ !T@  @   @ @ @ 1@ @ @   ( (Ą@ (!(@ @ /@ @  ( (Ą@ (!(@ @    @ @ H@ @  H/ w I/ x P/ u Q/ t W/ v '  $ ' d ' ` ' h ' l / u / t d' d%"' `' h +' l / u / t d' d/ / y' <'!X b@"  d`2 d d0' d d!l!l!l d /  d 2 `"` / `"`  / ` "` / `@"' p / ' p |2 p`! p ' p!@! 4@'!ؐ!@ ('!'! '!@/!D@'    @  b@   @ @`  0' ' @   @  @  #@  @   @#@ @'  @@7!J@7!H  "@  "@ @ @@@@@@ @ !T@  @   @ @ @  @    @@ @?@' 㿠`<EA   @ cL?@&P  @  @ @  @  @@@@ T@  @ @@&@㿘     @*  @? :  @  : @     L@ `T @ @@ @@ @@ @  @ "00 #d#\@#`0 8,  `@ @ ` `(`@` @m@ " `؀ 2```؀Hd`؀5/-@@@`2`|`؀`؀2`|@@`@%`|`| @%`|@ 2`& @" d `<@@ `<%`<%``<@%`<" ' @%`@@@@@  @ 㿘  1 @+0` ` `@` /@/`Đ@'`Ė  @` @@'`IJ  @/ @(`@`Ā '`@  ?"?@ @㿠 @  `@@@  @`` @`<@%`<````` c@`@aL@aX2` %aX`<%`<``䀠3` ` @ @`@ @`@`` "   ސ@`d    @ @   `   " `(`  &`@cL@  @`  @` @`  @`  @`@@@%`<%aX@%`@" %`D`@@`D%`D@?@%aP`@`@`@ daT@`  @`@@%``%`h%`d-aD-`%`%``|@`(@5@@%`<%aX@%`@" & `D"%```@@`D%`D%``%`h?%`d-aD-`%`%``|@`( @ @@㿠1  " `  @ ` `2 "  @   @@' D  @    @ @  `( ` ,'`` " ` " " "           "`     @ `@`'` 㿠@"  @   @ @`@ @` ` &  HHH㿘  ' @ @   @   @ @  @@  ` `    @@ D@ D& D@`@@@ @ 1 d6 "~`w"tx`  o"O`i`  "``` h  L"IM` Bg" C` ij" j6` 4 " !`L"I``  >"  `J"G `  8"`` `"] `W" `bz5 9"+ `" `1  " `" ` z{"``U"!`"er`1a,  <"`[`= "-`Q` H 1"<& C`a1 1-1"*& 1`a#1" & '`11"& ` 2 `` "` `& `  * ``@   2  ??&  2    (( &  0   02  ' d  ??&  d &  ' d ' `   H' l  ' h / u / t / v / w @/ x@@& ` `   @ @ `?' ` d ' d l H' l h ' h ? `' `  d' d  l' l  h' h / w @/ x@& @`"i&  ` d h@ l& _` 2` T`  @  "!l!l7!l?7!l@@& 9`  3``  @ @ 2#`!l ``  '` ` &  ``" `  @` "`& `   @   @W ,& ``"&  @ & ``  @ @ 2``@  `?6  H d 6  l 6  h@6 @ '` ` & `'``    d@!@@{ $2``@  d& `" `@  `&  l&  h& ` H@ H @ `@@ $'` ` & `'``"X`@S``" ` @ `  "<& @ & 7`@ & 1`@ @ & )` `"   ` @    "&  " & @ & `@ & `@ & `@ & `2`` @ @ 2`@   @ @ 2`!D   ' '  ' ' @@'"`'`   '` ` & ` 2``@ @2`@ "   ` @  "` u` "` '` '@ "    ' (' ' @`@@<`@ 21`@ `  @ @ 2`` 2 2 2 '6 (2``'&2` "  2  "  2  "  2    2  '` ` & ``"   @  @ 2`@ `  2  "   "    @/ y  @@& `@& `  @2`@  " ` @ @@ @@" `` @'!`a`  X Z` @/P` `@ @2=`@ @ 23`  @` ` X` `"` X@ `@ ` `  & ` $@2`@ @Ԓ $2`` "   (`l 0 |"``2`` `$  $& `  $@2`@  $"  ` " (`n  0@` @2`@ @w 2``!8 ` ` ` ` ` 0` 0` (` `  & j` g`  a`@F 2[``!d @  '` ` & J`2` D`!d @ & =`!̐@ 2`!@ '`!@ `!А@ `!D   '' @`@ '!! '! '! '!!'!! '!'!'! '!!'! !'!!!'! @'!Ș 4@``"   `@  "  2  `    !؄ ;@'!` @ @@& 2``  `@   #@ @' !'  4' @' @``"   `@  "u  2q `"m @` "  ' ' @@& Y`"   `@  "  2  `    ?` 2<`@ @'!& 3`"   `@  "  2  `    ` 2`@ @'!&  `    @` @  `    @ `( `"&@ &`( `"&@&  @@ ` @@`@ 㿠" @@  @ @D`@&D@@㿠 " @ 2` ?` ` "`` "`@`"`@``@`@ " `` @@` `4 "Z `""``` N"Ku`E"`l`  "`Y``"`O`  ,")`A`#"`8`` " `@`  @2` ` ` 3`3`3`2 ` `&2 "`3`"`3`"`3`"``3``   ``@` `(  &` &` &`` ` @  ` " `@` `  2  "   "   ".y .y"`@` " `@`"`@`&``"' @`'`' ' ' " `@`  @%` ` ` D #   #   #    #   #  @ @# "` # `#  `    `  `       #\@ `(  &` &` &`` ` @  `  ` 2 `  @ " &(&&@@`"`@`&``"' @`'`' ' ' ` "`@`@`'`@`'  ' ' ` @&``"`@`&``"' @`'`' ' ' `  @ Q  @` `X` `"`X@ `#@ ` `  `(  &` &` &`` ` @   $@ j` " (`l 0|`2`` `$  `(  $&` &` &`` ` @   "(`n  0@b@2 `   @ `"`@`&``"' @`'`' ' ' @ ` @ '  `(  ' ` ( @ 㿠` @ ` @2@ `2  @@ " @ `@`   # c "p  y * "   Ȁ ƀ "   "`     `@`@ @`@`  @,@@ @=@": H @3@"0 > @)@%@"" 0  @@@@"  @ z@{@2   ` @`@3 ` @`@#  ` @`@" @   @  * @@` @ 2`&` 2`&` 2`&` `&`@   O  "/G   @ H   @ @  "@ aH0 `t ??@`t   @ %  "@ aH0 `u ??@`u   @  d@ @l  `@`@] `@`@O "  `@` 1@  $ @7 &  @  <& #& & =& `t" `u2 &  $@ @  @@ 㿘@   ` `  ` `@``@`<2`D@@ "   @ `@`    "B P 2" @` @`@`@"``@```"1aXaX"-aX " aX`@`aX@ a\7a\/ /a\7 @'aX  @`@@"'aX@  @@@@" @@2@ @ @ " `@` `@`@L"'@`' `@L`@` ? `! a؀;"?`&_`A 1 @`@`@ @`'` "  ``@` @` `'`` @'` @ $ 2``@L "% @% % @ʐ @``@L @@`<@'`<@"s``@`<j `@`   @W`,@  "    @@`@`@`<@@'`< (@'`8@ (@ @ `  @`@L ``@`<@"  `@` 㿠  3b@ " @ @@"h  \W @P@0"  @  @@L @ "@@@L @@2   @  @@2  @ T   `@`#\#`  @ 1   `@```.```` `(@ //!n!v7 !p7!r7 !t/ !u@/ؐ!~@ @ P @`" @@'`̶   //` 7` @`@'`  @``  " ` @`@` @'` /` /` @`Đ@'`Ė  @` `` @@'`Ķ  "~ ` @`@`Đ @'`q ` @ /@`d7@``7@`h7`p7a7'@''"`@`d`//`u"`t`u/`t"`u`t/`u.``t2/.`0?ń(7//`v//////@'` @`@'` ( @` `@@'`   "  @`@` @'`  /|/}/~/` @ ` |` @`@'`|  @` `` @@'`  " ` @`@` @'`  /x/y` 7z` @`@'`x  @` `` @@'`  " ` @`@` @'`  /tt/u  @`"    /pp/q  @`"t  q  /X/Y!'d`'h'\ '` 'l` @`@'`X  @` `` @@'` J "H ` @`@` @'`;  T/T  @`"/  ,  /PP7R  @`"    /L/ML/N  @`"     " @ @@ #\#`#d``@`㿘@@ @  @  @'!1@ &  ?  #\@ !@ & 㿠@@@@㿠  3a@ @x  #\5@ @@  @?#``#h`<`8`0#d  @?N#\d` H1@#h$E#h$A `,  #b@2% "@@`D@ ը#h@ ?#\#h@Ɛd` h#d`#`#h &`\㿠 3  ab@ @@``` `"`@`2?`  &`?,0a?@ \`a@ 㿠 㿠 㿠`  @& & ?㿠iO+ "?H:"9X}ᄄ5"o   !" p\ᄀh" O !ij"9ᄄ "+ᄐ" <ᄀ "T `D""֖ᄄ"Ж ᄐ`b"UXҖᄀR}"t$Ŗ1!"{g^z"Qᄄ`{H1,1"+|ᄐ!1#1"1"!ᄀ11"ᄁ d p        Ё ؁       0 <  P  ` h  x      ਁ ఁ  Ё      0  H  ` l x  㿠 `@`#` ```"n !`k` "l !` ` g` "h ,!` e` "f <!```_`"` L!`]`"^ `!`[`\`"] !````T`"U t!`R`"S m!`P`Q`"R d!```K`"L Y!`I`"J R!`G`H`"I! I!  $ 4 D X l x     ́  !㿠 ` %`` `n`A`"B h 耢`?`"@ 4a 耢``;`"< LX 耢`9`": dQ 耢``  ` 3` 4` "5 D 耢` 2` "3 = 耢``.`"/ 4 耢`,`"- -   ( @ X p    ́㿠`0       0" 0    @@ `@` @(6 a (6 b!(6 d"(6 h$(6 ((6 㿠     `(2` `(2` `(2` `(2` @` (2` `@(2`!`(2`"a(2`$b(2`(d(2`h(2`" @ (2`@(2` 㿠      (2   (2   (2  (2 Hd ,<HT`lx㿠 d!l!`   z* ` 8 2K Kp n W I  ȁ!,"X$')` %8Kp,%㿘@ . ( ((@(㿠" :@&2@ & " *` @ (`  @*` @ (`ȁ @aa""*` @ (` @؁ @*` @ (` @ @*` @ (` @ @*` @ (` @ @*` @ (` @ @*` @ (` @ @㿠.` (  㿠.` (  㿠.` (  㿠.` (  㿠.` ($ ( 㿠.` (, 0 㿠.` (4 8 㿠.` (< @ 㿠.` (D H 㿠.` (L P 㿠.` (T X 㿠.` (\ ` 㿠.` (d h 㿠.` (d h 㿠&㿠&㿠  `` *   㿠   "`  *`` + ` & ?㿠6`` (&㿠6`` (8 &㿠aa|&a&   ``&  +` +   a|&    " <a|  + 2a| a&a|axaa&㿠6  ?. 0 ( ??#㿠  >@( @㿠 㿠` >   @:  *` @ @2 㿠% ?@@ @: *  @ @@@2 㿠@*   <@  @  :  *`@ @2  '@㿠   T 㿠   T㿠1!t@.` (" !@6@!Đ @"`4 㿠1!t@`"  .` (!@6@!@" 4 㿠`1!t@ ?.` !(!Đ?$ 㿠t@"  `4 㿘t@&$x &$| @&$p&$t&$h &$l//7@ &$` 㿘t@&$x &$| @&$p&$t&$h &$l//777@ &$` 㿠t$`? @@$`&$`$t&$t$p$t$$p?$t$` X&$` t㿠`""&`x|&&``L0`Hpt D 6Dpt &` &`*`` 㿠t$`? @@$`&$`$|&$|$x$|$$x?$|$` X&$` t㿠`2` L0`Hx| D 6Dx| &` &`*``t㿠dxd|6 dpdxd| 6d|dxd| d|"d|d`&@`T"d`d|dx2dpd``X"d`dpdt dp dt  6dtdpdt dt"dtd``T"d`dtdp"d``X"d` 2?㿠1!td`2dx?d|"dp?dt"d`?&`! @dh?dl!(!dl() ")  dpdx " ?&d` 㿠& & (& 0& 8& @& H& P& X& `& h& p& x& & & & & & & 㿘5t@  @h? @ @̐??@.  (@@$@$@$@$@$@ // @// 77@ @ X  " ' @ X '  @@l$@p$@㿘1!t@!h?@  ?/`@/ @`&`! @ 㿘1!t@ ? //@7 @&! @/` (!!  㿠 ."* a   & @    @  㿠.` (@@@㿠.` ( !`4 㿘t@ // 7 @77&$x &$|&$p&$t&$h&$l@ &$` 㿐t@@ // 77 7&dx`@&d|&dp&dt&dh&dl@` &d` ?7 @7 㿘1!t@  ?/@/7 @&! @ 㿘1!t!h?@  ?/@/77 7@&! @ 㿘1!t!h?@  ?/@/77 7@&! @ 㿘3at@@ah@ ? @  / /@77@@X  " &@X &a @@ 㿘1!t!h?@  ?/@/77 @&! @ 㿘1!t!h?@  ?/ @/// 77@ ' ! @ 㿠&?@ &  `?2 @2 @ & ?          㿠     @@ & 㿠@*  (ᴲ\"` 㿠.` (lp   " d? @ @@'  &d  @@ @@ @ ' &d  ' &d 㿠?㿠.` (l``2`?"```` "`㿠.` (l 㿠.` (l "@&  &  @& & @"  & @& &㿠.` (l   㿠.` (l   㿠&?@ 4&  `?2 @2 @ & ?            0 㿠     @@ & 㿠@*  (ᴠ\& @p㿈.` p(    ` ?&" `@M #` @ # @ "? @ @?  @$    @ @@ @ $    $  ?㿠*   @(   @  &@@ @㿠   &   &   &   & $㿠.` (ᴲ`2?20 1"(s?(      * &0(    , . &0(( ";D?`( `,@? )@*) *`0 `4@?),@.) *,.0  㿠``2`&&& `  &`` &`&  &  ` &`&`  & &  㿠.` (ᴄ@ 㿠.` (ᴄ@ 㿠.` (ᴄ " " $"  $ 2   2  $   " " " 0  2      "     "  㿠.` (ᴄ````` # "  ` `#`` `#`` `` `` # "  ` `#` `$`$#` `$` `` `$` ` #`#` #`0 㿠.` (ᴄ?    ?E 㿠.` (ᴄ?   $  ?# 㿠.` (p 2    2 㿠pd|x@ x?|| @@&|x@2&dX &dp㿠dL0Hx| D 6Dx| &` &`*``㿠pdx|@x | @X x&|?tt pp?tt @&tp2&dX &dp㿠dx|6L&` 2H pt D 6Dpt &` &`*``p㿠dx|6px| 6|x| |"|T@|x&@2pX`pt6"dp t  6tpt t"tT@tp"2"dX`"d 2?p㿠dX d 㿐`@  @`  @`X   @`X &dd@( (1!&`&p&t&x&|` W W@`$W W`$` W􀠿 !@Q&` 㿘`@  @` &dd@*  (1!`@`D!@(&`㿘`@  @` 'dd'dp'dt'dx'd|( ("d@ƀ`T'dd㿘@@  @ &d&p&t&x&|*  (@" T&d㿘`@  @` &dd( (ᴐ  " @㿐@  @  @X @&d*  (@  " W WT&d㿐@  @  @X @&d*  (@  " W WT&d㿐@  @  @X @&d*` (@,0`" W ?W@T&d㿐@  @  @X @&d*  (@<@`" W W@T&d㿐@  @  @X @&d*  (@LP " W WT&d㿐@  @ &p&t &x&|@X @&d*  (@\`" W WT&d㿘`@  @` &dd@*  (dh <P(dx㿠` ``Pxv`Phf``1!@`P`@l   C* `aEdd@ddے;dd 6dd;1dd,dd'dd"ddCddsdddd>dd@ `!l '?dd'` `  @ @l &?@l &?㿠!p!l@!  @@   @" 㿠!p!l@!  @@  @     㿠"@2&@ &H L H㿠1!x!|@!@@!x,  (@! @@  @,  (@`@!x@ $@@@$@㿠l @@ 㿠  &  &  @ &   &  & 㿠& @& `` @ ?&(' ' (  @"?`& @   @` 㿠   ("&@ (& (&    @``* &㿠@@$@ @㿠@  &@  &@  &@  & @  &@  &@ & &  `   @ &``(   "   ( 㿠@(h"h@@h@&(@@hDhD&(D@hHhH&(H@hL&(LhL&(L$ |zd 㿠 @@`$  @$ `X h` " @" &  @*$d$$ $$X hd@" @" & $*@'h@@ 'hD@$'hH@$'hL㿠@ 1!@ " 4@!h'@@d!p'@!t'@!p!t'@d'@!t?@@ ``@?@d? | Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456< dgasy_CDataCB:(%X/%X) allocb failed > dgasy: Memory low; %d bytes dropped (instance %d, port %d).dgasy: CDataCB:(%X/%X) No read queue.dgasy: No read queue; %d bytes dropped (instance %d, port %d).%X/%X: q_count=%ld dgasy: DataCB:(%X/%X) Can't do putnext. %X/%X: RX:%d bytes %c-%c,i2 dgasy: Control message from dxb too large. %d*** dgasy_CDataCB (%X/%X): %s dgasy_CDataCB:SYNC dgasy_CDataCB:bufsize insize=%d outsize=%d dgasy_CDataCB:mstat dgasy_CDataCB:mstat=0x%x DTR: %d RTS: %d CTS: %d DSR: %d RI: %d CD: %d dgasy_CDataCB:event < event:(%X/%X) got BREAK! > dgasy_CDataCB:lerr dgasy_CDataCB:param (0x%x) dgasy_CDataCB:param, cflag=0x%x, speed=%d dgasy_CDataCB:param, old cfl=0x%x, spd=%d dgasy_CDataCB:param, cflag=0x%x, speed=%d ctrl_len=0x%x dgasy_CDataCB/SDXB_SEQ (%X/%X): RIN=%d, TOUT=%d RIN=%d, TOUT=%d dgasy_CDataCB:frame excp flags=%x dgasy_CDataCB:Unknown control Packet received. cmd=%d| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456Credit callback on unopened port (%d) fl=%x Credit callback : board %x, dxb %x| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456RECEIVED DATA, BUT PORT IS NOT OPEN, q=0x%x, flags=0x%x, port=%d dgasy: Data received at closed port; %d bytes dropped (instance %d, port %d).< dgasy_DataCB:(%X/%X) allocb failed > dgasy: Memory low; %d bytes dropped (instance %d, port %d).dgasy_DataCB: Copying %d bytes (mblk size = %d) to 0x%x dgasy: DataCB:(%X/%X) No read queue. dgasy: No read queue; %d bytes dropped (instance %d, port %d).%X/%X: q_count=%ld dgasy: DataCB:(%X/%X) Can not do putnext. %X/%X: RX:%d bytes %c-%c,i4 | Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456OpenAckCB:OpenAckd = 0x%x and its value is %x OpenAckCB error:0x%x | Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456dgasy_SendCtrlPkt: pktlen=0x%x *** dgasy_SendCtrlPkt (%X/%X): %s dgasy_SendCtrlPkt: No Space Available | Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456dgasy_FlushBuffers (%X/%X): Flushing output. dgasy_FlushBuffers (%X/%X): Flushing input. < assert: line=%d %s >| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456< param:(%X/%X) > ALTPIN is ON ALTPIN is OFF < param: exit > < poll: AFTER waketime > | Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456dgasy_fini: instance=%d dgasy: dgasy_init(%d): Invalid Board Structure at 0x%x:< dgasy_init, board=0x%x > dgasy: dgasy_init: Unable to alloc Asynbrd_t: %d.board->TotalChannels=%ddgasy: dgasy_init: Unable to alloc Port_t, port=%d=== dxb_open (%X/%X) dgasy: dxb_open timed out dgasy: dgasy_open ack interrupted dgasy: dgasy_open ack timeout dgasy: dgasy_open openack failed dgasy: dgasy_open openack is false: channel:%u ALLOC CREDITS:(%X/%X): fixed_cost=0x%x, credits=0x%x > ALLOC CREDITS DONE:(%X/%X): fixed_cost=0x%x, credits=0x%x > ALTPIN is ON SET LTIME send seqpkt send event packet SET up queue pointers | Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456dgasy: bad instance number requesteddgasy: board not attatched yet dgasy: dgasy_open: NULL pointer: board:%x rdq:%x EAGAIN-1 EINTR-1 ===== open (%X/%X) dgasy: dgasy_open: board(0x%x)->asynbrdp is NULL< open: idata=0x%x, rdq=%x channel=%d/%d flag=%x, idataptr=0x%x, board=0x%x, maxchan=%d > dgasy: dgasy_open: invalid channel number:%xdgasy: dgasy_open: port is NULLdgasy: dgasy_open: dxb is NULL| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456dgasy_SDXB_drain:(%X/%X) > EINTR-6 < dgasy_SDXB_drain: exit %d> < close:(q=0x%x) return(ENXIO) > < close:(port=0x%x) return(ENXIO) > DIGIras: BAD Q pointer < close:(%X/%X) discard pending IOCTL > dgasy: dgasy_close:(%x) failed > ===== close (%X/%X) chan(%d), openackd (%x) < dgasy_SDXB_drain on port %d at %x < dgasy_SDXB_drain done on port %d at %x < close:(%X/%X) discard pending IOCTL > < dgasy_transp:(%X/%X) TRANSPARENT ioctl, request size = %x> < dgasy_transp:(%X/%X) allocb failed > EAGAIN-4 < dgasy_transp:(%X/%X) tr_ioc_cmd:%x tr_ioc_ptr:%x > dgasy_ioctl dgasy: dgasy_ioctl: port is NULL dgasy: dgasy_ioctl: board is NULL dgasy: dgasy_ioctl: rdq is NULL dgasy: dgasy_ioctl: wrq is NULL < ioctl:(%X/%X) cmd=%x > dgasy_ioctl: %s *** dgasy_ioctl (%X/%X): %s < ioctl:(%X/%X) TCSETA* ioc_cmd %x cflag=%x> < ioctl:(%x) iflags=%x cflags=%x oflag=%x lflag=%x > < ioctl:(%X/%X) TIOCSSOFTCAR %d > < ioctl:(%X/%X) TIOCGSOFTCAR > < ioctl:(%X/%X) TCSBRK ioc_cmd:%x > < ioctl:(%X/%X) TIOCSBRK ioc_cmd:%x > < ioctl:(%X/%X) TIOCCBRK > < ioctl:(%X/%X) TCGETA port=%x > < ioctl:(%X/%X) TCGETS port=%x, cflag=%x, speed=%d > TCGETS cflag in tios structure = %x TCGETS bcopy TCGETS bcopy done TCGETS break < ioctl:(%X/%X) TCFLSH > < ioctl:(%X/%X) TCXONC flags=%x > TRANSPARENT < ioctl:(%X/%X) TIOCMGET > TRANSPARENT < ioctl:(%X/%X) TIOCM* setting modem lines %x > < ioctl: calling param > < ioctl:(%X/%X) TCGETX > < ioctl:(%X/%X) TCSETX* > | Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456TRANSPARENT intr_period=%d| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456< ioctl:(%X/%X) unknown IOCTL type:%x > rtn < ioctl:(%X/%X) IOCTL=%x error=%x > NAK ACK dgasy: dgasy_ioctl: bad q %x return from dgasy_ioctl < reioctl: dev=%x > dgasy_iocdata < iocdata: rval != 0 > dgasy_iocdata: %s < iocdata:(%X/%X) TCGETX > < iocdata:(%X/%X) GETX: hflag=0x%x, cflag=0x%x, sflag=0x%x > < iocdata:(%X/%X) TCSETX > < iocdata:(%X/%X) SETX: > < iocdata:(%X/%X) TIOCMGET > (TIOCMGET) DTR: %d RTS %d CTS: %d DSR: %d CD: %d RI: %d < iocdata:TR_IOC_RESP response exit > intr_period=%d| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456dgasy: unrecognized ioctl in dgasy_iocdata(): %08X (%s)dgasy_wput: type=0x%x, port=0x%x dgasy_wput(ENXIO): wrq=0x%x, port=0x%x ----- dgasy_wput (%X/%X): %s wput:(%X/%X) 0x%x data bytes > ----- dgasy_wput/M_IOCTL (%X/%X): %s wput:(%X/%X) IOCTL 0x%x enqueued wput:(%X/%X) IOCTL type=0x%x < wput:(%X/%X) M_IOCDATA type %x > | Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456< wput:(%X/%X) break request > < wput:(%X/%X) delay request > < wput:(%X/%X) M_CTL > dgasy_wput:unknown STR msg type=x%x mp=x%x dgasy: wsrv< wsrv:(%X/%X) wrq=%x > < wsrv:(%X/%X) reschedules: flags=%x > ----- dgasy_wsrv (%X/%X): %s (%x)M_IOCTL ----- dgasy_wsrv/M_IOCTL (%X/%X): %s port->TInfo.tin=0x%lX, tout=0x%lX < wsrv:(%X/%X) M_IOCTL goto pause > < wsrv:(%X/%X) M_IOCTL set and flush > < wsrv:(%X/%X) M_IOCTL do ioctl > (%x)M_DATA < wsrv:dxb_write(%x) data sent=0x%x: > dgasy_wsrv (%X/%X): TIN=%d port->TInfo.tin=0x%lX < wsrv:(%X/%X) M_BREAK > < wsrv:(%X/%X) M_DELAY for %d/%d seconds > < wsrv:(%X/%X) unknown packet type 0x%x > < wsrv:(%X/%X) paused: flags %x > < wsrv:(%X/%X) exit > | Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456dgasy: rsrv dgasy: rsrv getq loop %X/%X: %c-%c,o3 dgasy: rsrv return %d credits dgasy: rsrv putbq dgasy: putbq() failed; %d bytes dropped (instance %d, port %d).dgasy: rsrv done processing messages --> dgasy_Send_SDXB_Cmd(%d (%X/%X), %s, flags=0x%X, opt1=0x%X, opt2=0x%X) dgasy_Send_SDXB_Cmd:(%X/%X) CMD=%x > < param: speed %d cflag %x > MINT=0x%02X, MOUT=0x%02X dgasy: dgasy_Send_SDXB_Cmd: 0x%x not supported < dgasy_Send_SDXB_Cmd: exit %d> <-- dgasy_Send_SDXB_Cmd(%d (%X/%X), %s, flags=0x%X, opt1=0x%X, opt2=0x%X)=%d _init mod_install failed Digi DataFire RAS/AccelePort Xp DGASY driver (v. %s, %s) loaded. Copyright (C) 1998-2000 Digi International. All rights reserved. _fini in _fini out | Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456dgasy_attach: instance=%d < dgasy_attach > cmd is not DDI_ATTACH, 0x%xdgras%s%02d%sMaking node %s (minor=%d)... dgasy: Could not build device nodes.| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456dgasy_detach: instance %d | Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456dxb_data(%d, %d) dxb_cdata(%x, %d, %d, %d, %d) dxb_open(%x, %s, %d, (%d), %d) dxb_close(%x, %d) dxb_return_credits(%d, %d) dxb_return_fixed_cost(%d, %d) = %d dxb_ioctl(%d, 0x%04x, %d) dxb_ioctlack(%d, %d, %d, %d) dxb_push(%d, %s, %x, %d) Error: dxblib user has botched credits dxb_dxbuf_poll_one: no DATA_CB! dxb_dxdata_cb(%d, %d, %x) data[0] = 0x%x dxb_dxbuf_poll_one: no CDATA_CB! dxb_dxcdata_cb(%d, %d, %d, %x) ctrl[0] = 0x%x process_openack (%d) dxb_openack_cb(%d, %d, %d) process_closeack(%d) dxb_data_cb(%d, %d, %x) data[0] = 0x%x process_cdata process_credit %d credits process_pushack process_popack process_linkack process_unlinkack process_flushack process_ioctlack process_cancel dxb_rxpoll: q->in=%x dxb_rxpoll: q->out=%x Unknown DXB message 0x%x in=%x out=%x dxb_buf: page[0].virt = %x dxb_uninit: freeing resources dxb_set_phys: dxb=%x phys=%x dxb_init: dxb=%x, npages=%d pagesize=%d openside=%d drv/dgdxbCopyright (c) 1988-2000 Digi International, Inc. All Rights Reserved. mgmtsnmptrace1_trace2_trace3_trace4_trace5_trace6_auxaauxbdgasyndxb!=NULL/export/home/dickl/sol_dense/dgasy/dgasyn.cport!=NULL/export/home/dickl/sol_dense/dgasy/dgasyn.cdxb!=NULL/export/home/dickl/sol_dense/dgasy/dgasyn.cport!=NULL/export/home/dickl/sol_dense/dgasy/dgasyn.cdxb!=NULL/export/home/dickl/sol_dense/dgasy/dgasyn.cport!=NULL/export/home/dickl/sol_dense/dgasy/dgasyn.cdxb!=NULL/export/home/dickl/sol_dense/dgasy/dgasyn.cport!=NULL/export/home/dickl/sol_dense/dgasy/dgasyn.cdxb!=NULL/export/home/dickl/sol_dense/dgasy/dgasyn.cport!=NULL/export/home/dickl/sol_dense/dgasy/dgasyn.cdxb!=NULL/export/home/dickl/sol_dense/dgasy/dgasyn.cpkt!=NULL/export/home/dickl/sol_dense/dgasy/dgasyn.cport!=NULL/export/home/dickl/sol_dense/dgasy/dgasyn.cport!=NULL/export/home/dickl/sol_dense/dgasy/dgasyn.cdxb!=NULL/export/home/dickl/sol_dense/dgasy/dgasyn.cport!=NULL/export/home/dickl/sol_dense/dgasy/dgasyn.cport is NULLnon-zero dgasy_poll_tdboard!=NULL/export/home/dickl/sol_dense/dgasy/dgasyn.cch_lockch_sv_opencloselockch_close_svch_sv_mstatch_sv_lerrch_sv_paramch_sv_seqch_sv_eventch_sv_syncch_flag_svch_sv_dxbopenTXPRINTSERIALrdq!=NULL/export/home/dickl/sol_dense/dgasy/dgasyn.cport!=NULL/export/home/dickl/sol_dense/dgasy/dgasyn.c0/export/home/dickl/sol_dense/dgasy/dgasyn.c0/export/home/dickl/sol_dense/dgasy/dgasyn.c< ioctl:(%X/%X) S_IOCGETMODE > < ioctl:(%X/%X) S_IOCGETMRU > < ioctl:(%X/%X) S_IOCGETMTU > < ioctl:(%X/%X) S_IOCGETSPEED > < ioctl:(%X/%X) S_IOCGETMCTL > < ioctl:(%X/%X) S_IOCGETSTATS > < ioctl:(%X/%X) S_IOCSETMODE > < ioctl:(%X/%X) S_IOCCLRSTATS > < ioctl:(%X/%X) S_IOCSETDTR > < ioctl:(%X/%X) S_IOCSETMRU > < ioctl:(%X/%X) S_IOCSETMTU > 0/export/home/dickl/sol_dense/dgasy/dgasyn.c0/export/home/dickl/sol_dense/dgasy/dgasyn.cdgasy_wsrv: freed non-empty bufferrdq!=NULL/export/home/dickl/sol_dense/dgasy/dgasyn.cDigi DGASY driver (v. G)G32-bitdgasy_dr_lockttymodesmodinfop!=NULL/export/home/dickl/sol_dense/dgasy/dgasyn.cdip!=NULL/export/home/dickl/sol_dense/dgasy/dgasyn.c,cu,tty,lpERRORddi_pseudodip!=NULL/export/home/dickl/sol_dense/dgasy/dgasyn.c0/export/home/dickl/sol_dense/dgasy/dgasyn.c0/export/home/dickl/sol_dense/dgasy/dgasyn.cTIOCGETDTIOCSETDEUC_WSETEUC_WGETEUC_MSAVEEUC_MRESTEUC_IXLOFFEUC_IXLONEUC_OXLOFFEUC_OXLONTCSBRKTIOCSBRKTIOCCBRKTCFLSHTCXONCTR_IOC_RESPTIOCGWINSZTIOCMGETTIOCMBISTIOCMBICTIOCMSETTCGETATCSETATCSETAWTCSETAFTCGETSTCSETSTCSETSWTCSETSFXIOCTCGETXTCSETXTCSETXWTCSETXFTIOCGSOFTCARTIOCSSOFTCARDIGI_SETBAUDDIGI_SETBAUDWDIGI_SETBAUDFDIGI_GETBAUDDIGI_GEDELAYDIGI_SEDELAYDIGI_GETBDDIGI_SETADIGI_GETADIGI_TCXONCDIGI_SCLOSEDIGI_GCLOSEDIGI_KME???M_DATAM_PROTOM_BREAKM_PASSFPM_EVENTM_SIGM_DELAYM_CTLM_IOCTLM_SETOPTSM_RSEM_IOCACKM_IOCNAKM_PCPROTOM_PCSIGM_READM_FLUSHM_STOPM_STARTM_HANGUPM_ERRORM_COPYINM_COPYOUTM_IOCDATAM_PCRSEM_STOPIM_STARTIM_PCEVENTM_UNHANGUP???SDXB_SYNCSDXB_BUFSIZESDXB_MSTATSDXB_EVENTSDXB_LERRSDXB_PCAPSDXB_PARAMSDXB_WMARKSDXB_SEQSDXB_SCIMMEDSDXB_BREAKSDXB_FLUSHSDXB_PAUSESDXB_SCRECVSDXB_FREXCPSDXB_MARKIDLESDXB_ISDNSDXB_PROTERR???0/export/home/dickl/sol_dense/dgasy/dgasyn.c     09(FbFVc<y8l4P(xXl\\&Pt:\dJ[lhDvp˄X,ϬМthtvhD-L;D Uc qP 0T@$,n` (Z, $05HF Vp(gs~$0|`x !3=L00^dp|4(D<(4`d״  (.<FDZàn0@0,Ęh7,3 \B<RHXdH u( 0L HD.7=RWX cl(}L<PP, l0*4 4,<>I|[Ytir0P$tT L0PP0,H( 0 T "<0 2P0 D G [, k y8 t    0 , D $  D   ' 7x LD  Z bt w  x  0@ 4   L    8 & 4, ? N V ct t         p0 8  $ + t, 8(| P0 alx j8 d D $  L   ( )0 # ($ 5 < K \ k  | `0     0    X'1D:5G(S|lhqxPHlfH (8|!< 7BIT@el|LL0@0, P/0l00E/export/home/dickl/sol_dense/dgasy/sparc/dgasydgasyn.cmgmtdev_namedgasy_copyrightdflt_termiosdgasy_prep_cont_blockdxblib.crightmost_onefind_openmap_zerofind_openmap_limitsdxb_buf_vaddrdxb_data0clear_callbacksinit_rxbufuninit_rxbufinit_dxbufuninit_dxbufdxb_dxbuf_copy_from_bufcompute_dxbuf_areasprocess_openackprocess_closeackprocess_dataprocess_cdataprocess_creditprocess_pushackprocess_popackprocess_linkackprocess_unlinkackprocess_flushackprocess_ioctlackprocess_canceldxb_buf_allocdxb_buf_copydgasy_rsrvdxb_set_open_cbdgasy_MYTICKSgetminordxb_dxbuf_copyindgasy_poll_tddgasy_modldrvdgasy_bytes_outdxb_polldxb_set_ioctlack_cbbzerodxb_write_ctrl_blockdgasy_write_debugdxb_rxbuf_flushdgasy_howldxb_dxbuf_data_locationsdgasy_wsrvdgasy_rinitdgasy_iocdatadxb_set_ioctl_cbdgasy_rsrv_debugdgasy_setup_dxbdxb_set_cdata_cbdgasy_lboltdxb_mallocdxb_set_credit_return_leveldgasy_sol2sdxb_cflagdxb_set_syncdatadxb_set_popack_cbqprocsoffdxb_popdxb_rxpoll_onedxb_phys_page_sizedxb_write_donecv_wait_sigdxb_dxbuf_advancecv_signaldxb_rxbuf_opendxb_set_unlink_cbfreebdgasy_schedmutex_entercv_destroydxb_dxbuf_opendgasy_detachdxb_data_credits_availdxb_unlinkdgasy_init_ccbcopydgasy_sdxb_debugdgasy_finidxb_rxbuf_getchardxb_free_pagedxb_uninitnulldevdelaymutex_destroydxb_flushdxb_peek_ctrl_writedxb_read_ctrl_blockdxb_set_cancelack_cbmutex_exitdxb_dxbuf_read_ctrl_blockqenabledxb_virt2busclear_openmap_bitdgdxb_board_pollingdxb_dxbuf_ctrl_locationsdxb_read_data_blockdgasy_pollhandle_ioctl_getputctldgasy_creditCBdxb_rxbuf_count_infokmem_zallocdxb_rxbuf_copyindxb_set_credit_cbsprintfdxb_dma_sync_for_hostmod_installdxb_set_userdataputqdgasy_ioccmd2strdgasy_baud_initcv_broadcastdgasy_module_id.umuldxb_phys_copydxb_rxpoll_internaldxb_linknodevdgdxb_board_attached.mul_depends_onqprocsondxb_set_close_cbRDdxb_return_fixed_costdxb_swaplongdgasy_attachLibdxbChandxb_initdgasy_check_carrierdxb_ioctldxb_rxbuf_set_copyoutdgasy_openflushqdgasy_open_debugdgasy_modlinkagedgasy_ioctl_debugdxb_printfdgasy_SendCtrlPktdgasy_reioctlnochpolldxb_set_linkack_cbdgasy_read_debugdxb_peek_ctrl_readdxb_rxbuf_copyin_with_headercv_initdxb_pushdxb_dxbuf_emptydxb_read_donedxb_set_data_cbdxb_set_flush_cbdgasy_paramdxb_queue_spacedxb_set_cancel_cbWRdxb_peek_data_writeset_openmap_bitmod_driveropsdxb_set_physdxb_canceldgasy_dbtype2strddi_prop_opkmem_allocdxb_set_link_cbdgasy_opsdgasy_wsrv_debugdxb_bytes_freedgasy_modldgasy_getinfokmem_freedxb_credit_awarddgasy_OpenAckCBdgasy_sol2sdxb_oflagdgasy_CDataCBtimeoutdxb_write_data_blockputnextdgasy_sdxbcmd2strdxb_peek_data_readdxb_dxbuf_locationsdgasy_closedxb_dxbuf_int_advanceuntimeoutdgasy_nscheddxb_dxbbuf_parmslboltdgasy_probedgasy_close_debugdgasy_dr_lockdgasy_infodxb_rxpoll_allfreemsgdrv_usectohzdgasy_CloseAckCBdxb_copy_to_buf_syncddi_create_minor_nodedgdxb_translation_tableputbqdgasy_identifydxb_copy_from_bufbufcallddi_root_nodedxb_set_pop_cbdxb_peek_wconfirmdxb_rxbuf_readallocbdgasy_DataCBdxb_cdata_payload_spacedgasy_init_debugdxb_datadgasy_openclose_unlockdxb_data_payload_spacedgasy_tenth_seconds_from_nowdxb_peek_rconfirmcv_timedwaitdxb_return_creditsmod_infodxb_ioctlackdxb_set_closeack_cbdgasy_destroy_dxbgetqdxb_buf_freeOTHERQdxb_txpoll_allddi_get_instancedgasy_bytes_indxb_bytes_queueddrv_getparmdxb_set_unlinkack_cbLibdxbChanOffsetputnextctl1dgasy_rinfodxb_cdatadxb_set_push_cbdigi_tracefdxb_alloc_pagecv_timedwait_sigdgasy_update_force_carrierLibdxbDxbdxb_opendgasy_transpdgasy_winitdgasy_openclose_lockdxb_freedgasy_Send_SDXB_Cmddxb_dma_sync_for_devdgasy_FlushBuffersdgasy_cb_opsdxb_dxbuf_read_data_blockdxb_txpoll_internaldgasy_wputdxb_set_openack_cbdxb_closedgasy_ioctldxb_set_credit_cb_on_spacemod_removestrlendgasy_initdgasy_wput_debugqreplydxb_space_availdgasy_nocreddgasy_poll_debug_finidxb_copy_to_buf_no_syncdxb_set_flushack_cbcmn_errcv_waitdxb_set_pushack_cbcanputnextdgasy_param_debugdxb_dxbuf_poll_onedgasy_SDXB_draindgasy_sol2sdxb_iflagmutex_init <i4 <i4cg: WorkShop Compilers 5.0 dev 28 Mar 1998 Build PUT_BUILDNUMBER_HERE@(#)eucioctl.h 1.10 93/11/01 SMI@(#)types.h 1.63 98/04/28 SMI@(#)isa_defs.h 1.15 97/11/22 SMI@(#)feature_tests.h 1.17 97/12/04 SMI@(#)machtypes.h 1.12 96/08/01 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)int_limits.h 1.5 98/01/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)types32.h 1.4 98/02/13 SMI@(#)select.h 1.16 98/04/27 SMI$Id: dgasyn.h,v 1.8 2000/01/10 21:21:17 emillan Exp $@(#)param.h 1.63 98/06/03 SMI@(#)dxbus.h 1.2 94/07/27@(#)conf.h 1.57 98/01/06 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.19 98/04/14 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)thread.h 1.89 98/06/07 SMI@(#)klwp.h 1.34 98/01/06 SMI@(#)condvar.h 1.10 98/02/18 SMI@(#)signal.h 1.53 98/06/30 SMI@(#)unistd.h 1.36 98/07/16 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.14 98/02/05 SMI@(#)time_impl.h 1.3 98/02/13 SMI@(#)pcb.h 1.30 98/01/06 SMI@(#)regset.h 1.23 98/03/09 SMI@(#)time.h 2.62 98/02/04 SMI@(#)msacct.h 1.7 93/07/13 SMI@(#)ucontext.h 1.25 97/09/28 SMI@(#)lwp.h 1.30 98/01/06 SMI@(#)synch.h 1.35 98/06/05 SMI@(#)systm.h 1.93 98/06/03 SMI@(#)proc.h 1.117 98/03/19 SMI@(#)cred.h 1.21 97/01/09 SMI@(#)user.h 1.56 98/06/30 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)model.h 1.20 97/09/22 SMI@(#)debug.h 1.22 97/05/15 SMI@(#)auxv.h 1.26 98/01/13 SMI@(#)errno.h 1.19 98/01/14 SMI@(#)timer.h 1.16 98/01/06 SMI@(#)watchpoint.h 1.6 98/01/06 SMI@(#)seg_enum.h 1.3 95/12/22 SMI@(#)copyops.h 1.3 97/07/07 SMI@(#)dditypes.h 1.26 98/03/04 SMI@(#)varargs.h 1.44 97/11/22 SMI@(#)va_list.h 1.11 97/11/22 SMI@(#)devops.h 1.37 98/01/06 SMI@(#)uio.h 1.29 97/06/29 SMI@(#)buf.h 1.43 98/07/14 SMI@(#)kstat.h 1.14 98/01/06 SMI@(#)poll.h 1.26 98/06/12 SMI@(#)as.h 1.68 98/06/04 SMI@(#)seg.h 1.54 98/05/25 SMI@(#)vnode.h 1.80 98/08/03 SMI@(#)faultcode.h 1.15 92/07/14 SMI@(#)hat.h 1.81 98/03/13 SMI@(#)page.h 1.112 98/06/29 SMI@(#)ddidmareq.h 1.25 98/01/24 SMI@(#)ddimapreq.h 1.14 96/06/25 SMI@(#)mman.h 1.36 98/06/04 SMI@(#)ddipropdefs.h 1.12 98/01/06 SMI@(#)ddidevmap.h 1.8 98/03/13 SMI@(#)nexusdefs.h 1.13 94/08/09 SMI@(#)aio_req.h 1.2 94/11/11 SMI@(#)file.h 1.56 98/07/28 SMI@(#)stropts.h 1.44 98/04/28 SMI@(#)stream.h 1.79 98/06/11 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)strlog.h 1.13 97/08/27 SMI@(#)kmem.h 1.26 98/01/06 SMI@(#)stat.h 1.45 98/03/24 SMI@(#)pci.h 1.19 98/01/22 SMI@(#)modctl.h 1.54 98/08/10 SMI@(#)ioccom.h 1.14 97/10/22 SMI@(#)strsun.h 1.15 98/04/28 SMI@(#)ddi.h 1.32 98/01/06 SMI@(#)map.h 1.23 98/02/25 SMI@(#)sunddi.h 1.90 98/06/29 SMI@(#)cmn_err.h 1.27 98/01/06 SMI@(#)ddi_implfuncs.h 1.21 98/01/06 SMI@(#)ddi_isa.h 1.6 97/04/09 SMI@(#)devctl.h 1.10 98/02/25 SMI@(#)dgaboard.h 1.0 1/29/98@(#)termios.h 1.38 98/02/20 SMI@(#)ttydev.h 1.7 92/07/14 SMI@(#)ser_sync.h 1.21 98/02/13 SMI@(#)stdigi.h 1.23 99/04/05$Header: /cvs_tick/sol_dense/include/stdigi.h,v 1.5 2000/02/16 16:00:09 emillan Exp $@(#)termio.h 1.11 96/02/07 SMI@(#)termiox.h 1.9 92/07/14 SMI@(#)strtty.h 1.11 98/01/06 SMI@(#)fcntl.h 1.44 98/06/04 SMI@(#)dgaboard.h 1.0 1/29/98@(#)dxbus.h 1.2 94/07/27@(#)stdigi.h 1.23 99/04/05$Header: /cvs_tick/sol_dense/include/stdigi.h,v 1.5 2000/02/16 16:00:09 emillan Exp $$Id: dgasyn.c,v 1.66 2001/09/29 17:46:05 kurte Exp $acomp: WorkShop Compilers 5.0 dev 28 Mar 1998 C 5.0 dev Build PUT_BUILDNUMBER_HEREcg: WorkShop Compilers 5.0 dev 28 Mar 1998 Build PUT_BUILDNUMBER_HERE@(#)types.h 1.63 98/04/28 SMI@(#)isa_defs.h 1.15 97/11/22 SMI@(#)feature_tests.h 1.17 97/12/04 SMI@(#)machtypes.h 1.12 96/08/01 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)int_limits.h 1.5 98/01/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)types32.h 1.4 98/02/13 SMI@(#)select.h 1.16 98/04/27 SMI@(#)sunddi.h 1.90 98/06/29 SMI@(#)dditypes.h 1.26 98/03/04 SMI@(#)ddipropdefs.h 1.12 98/01/06 SMI@(#)devops.h 1.37 98/01/06 SMI@(#)cred.h 1.21 97/01/09 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.19 98/04/14 SMI@(#)param.h 1.63 98/06/03 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)thread.h 1.89 98/06/07 SMI@(#)klwp.h 1.34 98/01/06 SMI@(#)condvar.h 1.10 98/02/18 SMI@(#)signal.h 1.53 98/06/30 SMI@(#)unistd.h 1.36 98/07/16 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.14 98/02/05 SMI@(#)time_impl.h 1.3 98/02/13 SMI@(#)pcb.h 1.30 98/01/06 SMI@(#)regset.h 1.23 98/03/09 SMI@(#)time.h 2.62 98/02/04 SMI@(#)msacct.h 1.7 93/07/13 SMI@(#)ucontext.h 1.25 97/09/28 SMI@(#)lwp.h 1.30 98/01/06 SMI@(#)synch.h 1.35 98/06/05 SMI@(#)uio.h 1.29 97/06/29 SMI@(#)buf.h 1.43 98/07/14 SMI@(#)kstat.h 1.14 98/01/06 SMI@(#)poll.h 1.26 98/06/12 SMI@(#)as.h 1.68 98/06/04 SMI@(#)watchpoint.h 1.6 98/01/06 SMI@(#)seg_enum.h 1.3 95/12/22 SMI@(#)copyops.h 1.3 97/07/07 SMI@(#)seg.h 1.54 98/05/25 SMI@(#)vnode.h 1.80 98/08/03 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)model.h 1.20 97/09/22 SMI@(#)debug.h 1.22 97/05/15 SMI@(#)faultcode.h 1.15 92/07/14 SMI@(#)hat.h 1.81 98/03/13 SMI@(#)page.h 1.112 98/06/29 SMI@(#)ddidmareq.h 1.25 98/01/24 SMI@(#)ddimapreq.h 1.14 96/06/25 SMI@(#)mman.h 1.36 98/06/04 SMI@(#)ddidevmap.h 1.8 98/03/13 SMI@(#)nexusdefs.h 1.13 94/08/09 SMI@(#)aio_req.h 1.2 94/11/11 SMI@(#)cmn_err.h 1.27 98/01/06 SMI@(#)va_list.h 1.11 97/11/22 SMI@(#)ddi_implfuncs.h 1.21 98/01/06 SMI@(#)ddi_isa.h 1.6 97/04/09 SMI@(#)devctl.h 1.10 98/02/25 SMI@(#)ddi.h 1.32 98/01/06 SMI@(#)map.h 1.23 98/02/25 SMI@(#)stream.h 1.79 98/06/11 SMI@(#)strmdep.h 1.10 98/01/06 SMIacomp: WorkShop Compilers 5.0 dev 28 Mar 1998 C 5.0 dev Build PUT_BUILDNUMBER_HERE.text.rodata1.plt.data.data1.bss.symtab.strtab.stab.index.comment.shstrtab.rela.text.rela.data.stab.indexstry x y| x d@t 8@  d@x 8@   d d> /L /H O@ D` dOD DOH HOL HPh tPl t   Pp x , Pt xS S S S T   T   $ $T4  , T` (Th (T HX 0 T HUx lU| lV4 V8 V \  V WP WT   W   < W 0 *d *` c c c  c  <  l @l @l D  l D    D  v| H  s pt s p  |  D$ |  | x x    D$  X X` X X     p p 0 ,   p   |  \       vx    ,      -0 ,xh P  ,  - h L +   L +l         +T     +TT 4 h 4  8  +8 8 h `  d  +8 - -  <  <x *  l  lp *\  -T   *       *  +  ,  , ) x ) xT ` +   8 \ < \ ) )\ ` 0 +     0< 8   h    8 +    d  d    8< x@ x 8    \   H  \ Hl 8  +0   ,x    + t dp d -0     )dP lF 8   )d6 6 h ` ` )HF 8q %@q %N 0 4  )HX $\ $q %p ,t , ( (ph $p $ D D (   (p $6 h6  (4 |8 |d (6 (6 ` d ` (o $6 n $0  . l/P  P P/T N ,  K D,  p pK D+ + J d + l pd $+ s< %  J  X X+ 8 < JL + 0H JD 0P ID + |0 } ( $  $} (. lO< * \* \ T T0 |4 (h|0 (h/ |/ |X X * 4* 4X X N 5 PI@  l l0 O 4L P *\ *X O 4 ,5 P  ,O T8 y\ (@@ yX (@X $X $y, 'P T8 <y$ '@ <x 'x 'xX 'xT '7\ x  'x7` 5\ $5X $8 8 8 8 8 8 x 'xw 'X9 ,9  ,90 P94 P9h t@ Pw 'XH Pw| 'Dwx 'D9p t9 9 4$ Y  L4  v ',v ',v 'v '9 9 Y LB  L lF4 B h l C v &v &" pl #vL &hvH &hv $Lv $Lu &u &C Ch ,Cl ,C PC PD pPT DP\ D \ \D pD $ x( xu0 %D H u, %D E$ t %t %t &Dtx &DY8 TY@ TE( E\ E` s@ %, it "  YT \s  %s %Yd \Y| \r %pr %pY |Y |F< 0 H r %dr  %dq %@Y Y H 0 0 ZT Z\ ( ( o $o $Z o $o $to $tZ / xip "/ xMH |n $0    n $$n| $$F `F `( PnD #n@ #m@ #m< #( Pm #m #f " " p1 l #, &P @1 1 1 l| #kd #kH #k@ #j "" " i "F p, F pi "i "1 fd !H$ h  "t1 #h #l h "tGD g "TMD |# # g "Tf "4f "4f " 1d t1\ t0  c !'t \[ ( ,( ,[ \ \ ] , c !] &X @f` !GL Gp Gt e !e !c0 !' lL `'8 P0  '@ PH( ,L 'l \bL ` ^l H^p Hc( !,D _ d' lbD ` L  `( _ (  _ _  d$<  T d $l   $ $ $ $ $ $| ` 1a 1a a a pa a Xa La Pa Pa a a  a ha ra ra sa s a s,a a a a a y8a y<a a z4a zTa a za za za {xa {a {a }La }Ta }a ~8a ~@a 0ta ~ta ~a a 4a ha ta a a Pa a a 0a a a a a a @a \a a /Da a /ta }% }% |% &@% &<% |%  % 4% (% (% %     ' ' '\ '( + " # ,(  X , T  # 1t 1p 4 5< 5@ 4 7, i i 5 5 Z8 6 7 7 8 8 8 Z4 Z0 Y Y f@ fD fH nd nl nh vD vD vD , 0 wP  h wL     rp rd r\       s\7 sP7 sL7 s87   u 2 2  2 u u uX uX X X 2X 2X uTG u\G udG G G G |5 5 5 (5 5 5 iglm$(_ $$_  @ D 2 ux 3P l u| ( p $ 2 3H 2 2 " " "!x!!l!$!c!4!8!!!8!|!`!9!"!e!x\!98!@!l!v!(!,!(!5! !!(!!/d!/ !/!Y! !*t!*!! t!! H! !*!!!!t!H!OT!!!<!8!0!!0! !P!!,! !!,!!,!!!! 68EdX2XFD<E,7FpFDF2,5`1GH1h9tGx CH, 7d  0HC00IH JH0LX BJ66K@ 69L4(/8CpX9DML+[ |8h#ps$ug @mDjOv VTV@ DPX<^t#$nHfsDtYpZmftLfh<n&Tu4l,`x xy`rZX+nU\hoi+pY(y0_$Xix]rhq'<vPW\'pcqxWpl@vooh_Xv'bHXwY<DY<`}wt0t8tXtt Tt8 \@`HwHP lw#X ` |HW klyz8Y9|YztYyYzYY(4Y(YYY{Y)TY{YY{\Y|Y{Y3Y}XY<Y}Y4LYa|Y~HYwY~YtY'Y*Y~YYhY@YY}0YXLY'YHY~YYWY+,YY4YVY4Y`YLYYV`YpYUY3XY&YYTYuY2YB$YYu<YEYY2`Y5Y-0YFlYY1Yt8Y$ YY1Y-Y YKY0 Y/Y Y8YMYYrY/YjY7Y |Y <YnY6PYoYY! Yr4YY"TYpY(ZZZZ ZZZZZZ0ZZ@ZZZZZ8ZZZ  | |ooToo do dopppp\p pL9  \ L \.TFm pmom6\m1$m2 m"8mm!mEm m" mmm2m m0lmmKmpm/mmpmqm!Lm 4m/m3LmHmNmm m5mN4m{mU4mkm.m~hm.m.tm.Hm8m"mm&m.$m~(m4m-m}m(mTmmBm-m3mmAm#m+mPmmstm+msmVm+mVmmumtmW$mtmtLm4m@mmWmX\mm'm(mwm~m*$m~m*m9mam(mm4<mupm}xmtmm(mm(mzmv(mzDm}<m}m|mzmmzm'mZ m\mm(m{hm'mZm{(mC (\xwwHwHwHwH|w#x "x c4| P 8)t 3 H"4 " ! ! {) ) 4d 4` 0}{Dl~p~X/z$z0@;;s|QHQ. R+`RR{R~TRlR}dRzRG G j4 G q| jP G >>s>CBRbaON W0V Ke(^eT '  'T   )@  ' ' k $ VX t D & kx k 2 k l l  & lT ll 2uL2Tu u  ($!"Du (8bhhHhT + {{)8)(@|hT1 ., - , "5.-rDԸ5T T4T-EH  !g(,g"Lg!3)"(l40,!)(H"h!04|)(@"`4t)(X"x(4h*4)".3l)h")|F"F3F# })}3}$:m:V|:p:P:&p:ۈ:&d:y``S`8`SD` `B`$0``A``\`U`z`F`4``E`<`*  *  0 +4r +8r 3*3.28'1 1 3M0M5M53ut7|a40xlf0_<f|j|5hlbelnuYb`t0fZs9benPZmtZbl|_XbJ\OKR4QIPMpN`6t6h 6d SvSvUPvT vTHvTviqZoZ99egJtn jlIKYlRL^@dfda(QMPONxjBoPfvxto$qqrrx(tXw,ww<${J{(DX  ~  Ѽ  / / .  /, /,| /L /L( . . . . . . .|, . .| .h 0 .h< 1X 04 04 1| 0x 0L 1  14P 1  /h$ 1  /h̨ 0< 2 4 2  1 1 /̤ 0 /4 /< /( 1 | /  14 / 0 0и 1HD 0L 0 1Hр 1pp 0l 0 1 1P 0 1pH 0H 0L׸ 1 1p  1 0h 0h 1 08 1X 0p | t l \ T Ȕq8q ,L،dـ٠lج`H$ll <         x   аth˸Ɉ̌Hˠ `(4\t4Ǭnjt@XLH<@@Lt@L׼L̬T̀,4 phԌ֐HHHLH H `    H     Ӽ0ӘєT t<׈dPPP$H @80( ,A00@PfTffXd`ptxhl\|\6dgasyn.cXa ; O ; V=3.1 ; R=WorkShop Compilers 5.0 dev 28 Mar 1998 C 5.0 dev Build PUT_BUILDNUMBER_HERE/export/home/dickl/sol_dense; /usr/bintools/cc -O -DSOLARIS -Dsparc -erroff=E_WHITE_SPACE_IN_DIRECTIVE -xCC -DSOLARIS7 -I/export/home/dickl/sol_dense/include -I/export/home/dickl/sol_dense/release/fepincl -I/export/home/dickl/sol_dense/libdxb -I/export/home/dickl/sol_dense/triboot -D_KERNEL -I/export/home/dickl/sol_dense/include -I/export/home/dickl/sol_dense/release/fepincl -I/export/home/dickl/sol_dense/libdxb -I/export/home/dickl/sol_dense/triboot -c -o /export/home/dickl/sol_dense/dgasy/sparc/dgasyn.o /export/home/dickl/sol_dense/dgasy/dgasyn.c -W0,-xpdxblib.cXa ; O ; V=3.1 ; R=WorkShop Compilers 5.0 dev 28 Mar 1998 C 5.0 dev Build PUT_BUILDNUMBER_HERE/export/home/dickl/sol_dense; /usr/bintools/cc -O -DSOLARIS -Dsparc -erroff=E_WHITE_SPACE_IN_DIRECTIVE -xCC -DSOLARIS7 -I/export/home/dickl/sol_dense/include -I/export/home/dickl/sol_dense/release/fepincl -I/export/home/dickl/sol_dense/libdxb -I/export/home/dickl/sol_dense/triboot -D_KERNEL -I/export/home/dickl/sol_dense/include -I/export/home/dickl/sol_dense/release/fepincl -I/export/home/dickl/sol_dense/libdxb -I/export/home/dickl/sol_dense/triboot -DDXB_HOST -c -o /export/home/dickl/sol_dense/dgdxb/sparc/dxblib.o /export/home/dickl/sol_dense/libdxb/dxblib.c -W0,-xp4L܀2A  "$d'$d0/7P7GTH CGL^({V^[ a@ lF070701000d8c22000081a40000023d000000640000000136a5804b00000060000000200000000700000000000000000000001c00000003reloc/kernel/drv/dgasy.conf# # Copyright (c) 1999, by Digi International, Inc. # name="dgasy" parent="pseudo" instance=0; 070701000d8c23000081a40000023d00000064000000013d2f24d0000282dc000000200000000700000000000000000000001700000003reloc/kernel/drv/dgdxbELF\4( 㿠@  $(@ @ @ @@  @  @  0 @  . @  ` ?# "`" "``` *#   @   @   @   @    @ @@ 㿠@ @& @&  "?@ & ?@?&?@ @@`0 ``@ @㿠   @"@ @<ddDh (Pܝ    @"'@@  @@ @ ?@@ 1"#@ "  ! `  `&`*6`` (`  6` "  @@? @ &clcl" clct@ 2&clclcL  @ctcT  @ cT @ &c c&cc`O @c`cb#@cd ` y* ``< @`&ch`P @`&ch`d @`&ch`x @`&ch` @`&ch` @`&ch` @` &ch`Ȑ @` &ch`ܐ @` ~&ch` @` t&cha @` j&cha @` `&ch @cd4cd B %* `a, @`E&cha@ @`<&chaT @` 2&chah @` (&cha| @` &cha @`&cha @`  &chaؐ @` &ch#h 1ab  @#F#h1 @  4b87 5@bD@  @ bP@b\@  @ & ,@ @ @@ @ q `@  @@ E ` @,`""h@h? @ %#p#l h @ @#ph@h? @ %#|#| @@ @   @cd @cb@  @#L@#T@`   ?(@ @@,`""@?@?@?bb @$ ?㿠   @$@   C <D@1@  @?@clc  @ct@.` " "  `?(@ @cL@  @?@?`,`0 @$``\`` @$c?㿈`` 7 7 @$w@1@  @?@  @? @  #\ #d#`@ @ ?@6c`@6cb.@6cdc`cb @cd@c`O cb#" cb@ c`cb @cd@ ?㿠 㿠` `@& @@2# ?& ?㿠    @$ 2  ,8@$ @L  . , (, ( @, F @L 㿠   @%`2 `,8 @%`@L`. @/`)`@L 㿘  'P @%3@"P  @? :  @  : `@: 0`+`: $((( (@`0@@$" &`@&` @s @ `@  cL@cT@ @ @ ` @  @  @1`0@ . .((( (``0 @$.`$`?$` $` $`cL@,`(@@``,  /` @`@@ @#@`c @`@@@,`+ @@ &%@`.'@ L`(  `K?`&L`( @@,`+ c4`,,`*,`F,`E$`P@$`\@`@`@ 4`4`4`$`$@$" @ @`@2u .@@@% @,`+ @@,`+  @  @     B@  .@ .@ .. ((( (`0@$.`$?&` &`&`.`(#6`,.`F .`E@$" @@  @ 㿠?88 (88(  @. (`  ` `@2 @ .` (` ,@`&㿘  `2 `  @&` 8`0@'`/`*/`F@/`E@@ /`+ `0 #L1 @?@/`)@@ `@`*@@@#@@ `@`*@@@'`/`*/`F/`E`P" '`P`H@`P"'`P@ '`P`\`@`\'`\` @@/`+ @ 98@`.'@ O`)  `?`&O`) @ @@/`+ @@/`+ @@/`+ @'`/`*/`F/`E`\"`P@`\'`\`P `H@`P@ @'`P@/`+ 㿠 @    "     : @  `&`@ .` &  㿠 @    "     : @  @, @  &  T&  $&  $& !86 #b" #b52#b 6 #b$2#b 6 #b#  6 #b@2  06  2 .        .  .  㿠   "     : @    @ @   "<&  "8&   ( /&   `" ` &  `" ` &  `" ` &  `" ` &  `" ` &  ` " `  &  `@" ` @&  `"  &  |2 !l" ` &  `" ` &  `" ` &  `" ` &  ` &  ` " `  &  ` " `  &  ` "&   & &  h" h &  h" h &  h" h &  h" h &  h" h &  h " h  &  h@" h @&  h" h &  h h2 h &  h h2 h &  h2 h &  h &  h h2 h &  h 2 h  &  h2 h &  h h   &  h h2 h &  h h 2&   & &  d d2 d &  d2 d &  d2 d &  d2 d &  d2 d &  d2 d &  d2 d &  d2 d &  d 2 d  &  d 2 d  &  d 2 d  &  d 2 d  &  d 2 d  &  d2 d &  d2 d &  d d02 d &  d0 2 d  &  d002 d 0&  d@" d @&  d" d &  d" d &  d" d &  d" d &  d" d &  d " d  &  d " d  &  d" d &  d "&   & &  !D" !D &  !D" !D &  !D" !D &  !D " !D  &  !D" !D &  !D@"  @&  &  & & "  & "  & "  & ".  &  & & & & & & &  2  @    (2  @  @  㿠``@  `` :`     * `` ` "`  㿠``@  `` :`    * ` @   ` ` "`  㿠  @ . `  *  @  @  㿠         @    `a \`   `  "  (E ` @D @D  $D . D  ` @Ĵ @Ą  $Ą . Ī    @@*` % @  @  㿠`A`=`   :     @  . @  #& #b& #d&  0& # ?#   ?#(`H.  .  @  㿠?." ````2``@ ?`2&` 㿠`?   `  "`@ & `@`&`@ 㿐 `  @`  " @&@  `" @`&`  ` @ &` ( `  &` &`" !@@ @>@0=@/@"3@@@"&a $[ sV Q ԐL G WB D29 &``"$``` `` #\#` @ g`` ` @ @ `"&`"`@&`;@`6$`` ` @@ @ @&`"& @`&`&  @&&` @(  @&` @`&`@ & `@(  㿐 `  @  @!@@ @5@)3@'@" )@@@"  (`  $`   ` `  `  ` D `H  " `2`  ` $` @`  @&`   "  $`$`$`  (    (  ,A' @ @Ӡ  " ' %   #\#` @ #\#` @@@$`' @ @ !@@ @>@0=@/@"3@@@"&IT iN I CD ? =: 5 Dw1   `( ``  ` ` ` (  &#\#` @W   @& &` @(  @ &  @(  㿠& 㿠&2  &#&#d& 0&  (& 㿠 & 㿠    & @&  (@  L @& H l@   @&  @ 㿐 ` 7 ``  / `` @ ` ``  `` `$ /`  @`  /` /` `  @` /` `  @`2` /` `1 @`` @ @@ y@E@"T`o`   @` /` B  ' P7``   @` /` `  @  /`  +` ' ".7` @/` `  @  /` "  ' 7`$  @  /`   $' 7`/`   @$ @ @  s/` @``  @` b/`  @&A  `; 7` $   ' @  #\#`  @#` #\  @" @  &/` @     @` /` ` @  `` @   @  @(  㿠   J P ",Q  ";J "  @ @  @ @@ @5@1@  8  @@@@ @@  @ @ @ 㿠@  @ @ @@2  @ 㿠@ ` ; @ @2` 㿠 @-@ @ 㿠 @-@ 㿠㿠?** @%@     2   & @  @ @ @ 㿠?* @@     2  " 㿠  . " `"`  ` `2`` &  @ 㾘'H'L 'P'T'X  ? @."@H@!  , @@.)@! @㾘'L'P'T`'X  ? @.9@L@!  , @@.@@! @㿘   @.M` `c$   @c @  c @'ccH#\cD#`c(#d  @c$@  c'ccD@  #\c@#dc0#` c$ CcH @cD@  7 c@c4@c8c'c(c@cH    @c(*cHc@ cc@ @` 㿠 2 # @.#"#@#$#'##"#@#(#'##@#$#'# 㿐 2  @.@D ( (0' 4'8'<@'.`    $ @A "@$􀠿 ,L @.􀠿!@2 %`& %`@ @ `@H %``%`` 2@@ Ȁ 㿠 2 # @.#. @#D   *`" * @ `@  㿠   @/`  @/ cH $  @c$@  㿠   @/ `  @/!cH $  @c$@  㿠  @"""l2 L@@@`` &@#@㿠 @  @" @㿠 @  @" @㿠 @  㿠 @  㿠 @`  @ #L@`0@`E @ `\"`P@`\'`\`P  @ q2+ `X*' `N"`"'`P@@@`T@@@'`P@`@`@@ @ `@@  @@@@@ `H"   ( '`P " @ &   @ '   (   '`P@`@`@@@㿠 2  1 n@   @  #L@ 0@ , F, D`s$ @L (p l @ @  $ @@ d@ @  $ @@ P` ,` &` ,2 c@ L@@ @@ @& @@ @ @@ @@ @@ @ @  $ @@ @  @@ @ *@ *@  㿠 @  0@E@ @P@ @H"     ( &P`"@`&` @& (  / &P@@@@㿠 @  0@ @ 2  E@ ) M (@   @ @#L5 N% X% T`% P\@% H   @ *" @% P @ @@@ *   @@ @ @((@% \@ 㿠.`. 7` 6`  :& @ @ @ @ @ & 6  6 6 .  (  ' 㿠@   3a@   3a@   3a@    ` 3a@ `઀ી @ @ @@@ @ @@@ 㿠   ""`2`6`` '`@@ @ @`` ` &  2 㿠  @"- ") \"  \   @@ & \ & "#l" #L@@ @ &@*` @ (`  @*` @ (`ȁ @aa""*` @ (` @؁ @*` @ (` @ @*` @ (` @ @*` @ (` @ @*` @ (` @ @*` @ (` @ @㿠.` (  㿠.` (  㿠.` (  㿠.` (  㿠.` ($ ( 㿠.` (, 0 㿠.` (4 8 㿠.` (< @ 㿠.` (D H 㿠.` (L P 㿠.` (T X 㿠.` (\ ` 㿠.` (d h 㿠.` (d h 㿠&㿠&㿠  `` *   㿠   "`  *`` + ` & ?㿠6`` (&㿠6`` (8 &㿠aa|&a&   ``&  +` +   a|&    " <a|  + 2a| a&a|axaa&㿠6  ?. 0 ( ??#㿠  >@( @㿠 㿠` >   @:  *` @ @2 㿠% ?@@ @: *  @ @@@2 㿠@*   <@  @  :  *`@ @2  '@㿠   T 㿠   T㿠1!t@.` (" !@6@!Đ @"`4 㿠1!t@`"  .` (!@6@!@" 4 㿠`1!t@ ?.` !(!Đ?$ 㿠t@"  `4 㿘t@&$x &$| @&$p&$t&$h &$l//7@ &$` 㿘t@&$x &$| @&$p&$t&$h &$l//777@ &$` 㿠t$`? @@$`&$`$t&$t$p$t$$p?$t$` X&$` t㿠`""&`x|&&``L0`Hpt D 6Dpt &` &`*`` 㿠t$`? @@$`&$`$|&$|$x$|$$x?$|$` X&$` t㿠`2` L0`Hx| D 6Dx| &` &`*``t㿠dxd|6 dpdxd| 6d|dxd| d|"d|d`&@`T"d`d|dx2dpd``X"d`dpdt dp dt  6dtdpdt dt"dtd``T"d`dtdp"d``X"d` 2?㿠1!td`2dx?d|"dp?dt"d`?&`! @dh?dl!(!dl() ")  dpdx " ?&d` 㿠& & (& 0& 8& @& H& P& X& `& h& p& x& & & & & & & 㿘5t@  @h? @ @̐??@.  (@@$@$@$@$@$@ // @// 77@ @ X  " ' @ X '  @@l$@p$@㿘1!t@!h?@  ?/`@/ @`&`! @ 㿘1!t@ ? //@7 @&! @/` (!!  㿠 ."* a   & @    @  㿠.` (@@@㿠.` ( !`4 㿘t@ // 7 @77&$x &$|&$p&$t&$h&$l@ &$` 㿐t@@ // 77 7&dx`@&d|&dp&dt&dh&dl@` &d` ?7 @7 㿘1!t@  ?/@/7 @&! @ 㿘1!t!h?@  ?/@/77 7@&! @ 㿘1!t!h?@  ?/@/77 7@&! @ 㿘3at@@ah@ ? @  / /@77@@X  " &@X &a @@ 㿘1!t!h?@  ?/@/77 @&! @ 㿘1!t!h?@  ?/ @/// 77@ ' ! @ 㿠&?@ &  `?2 @2 @ & ?          㿠     @@ & 㿠@*  (ᴲ\"` 㿠.` (lp   " d? @ @@'  &d  @@ @@ @ ' &d  ' &d 㿠?㿠.` (l``2`?"```` "`㿠.` (l 㿠.` (l "@&  &  @& & @"  & @& &㿠.` (l   㿠.` (l   㿠&?@ 4&  `?2 @2 @ & ?            0 㿠     @@ & 㿠@*  (ᴠ\& @p㿈.` p(    ` ?&" `@M #` @ # @ "? @ @?  @$    @ @@ @ $    $  ?㿠*   @(   @  &@@ @㿠   &   &   &   & $㿠.` (ᴲ`2?20 1"(s?(      * &0(    , . &0(( ";D?`( `,@? )@*) *`0 `4@?),@.) *,.0  㿠``2`&&& `  &`` &`&  &  ` &`&`  & &  㿠.` (ᴄ@ 㿠.` (ᴄ@ 㿠.` (ᴄ " " $"  $ 2   2  $   " " " 0  2      "     "  㿠.` (ᴄ````` # "  ` `#`` `#`` `` `` # "  ` `#` `$`$#` `$` `` `$` ` #`#` #`0 㿠.` (ᴄ?    ?E 㿠.` (ᴄ?   $  ?# 㿠.` (p 2    2 㿠pd|x@ x?|| @@&|x@2&dX &dp㿠dL0Hx| D 6Dx| &` &`*``㿠pdx|@x | @X x&|?tt pp?tt @&tp2&dX &dp㿠dx|6L&` 2H pt D 6Dpt &` &`*``p㿠dx|6px| 6|x| |"|T@|x&@2pX`pt6"dp t  6tpt t"tT@tp"2"dX`"d 2?p㿠dX d 㿐`@  @`  @`X   @`X &dd@( (1!&`&p&t&x&|` W W@`$W W`$` W􀠿 !@Q&` 㿘`@  @` &dd@*  (1!`@`D!@(&`㿘`@  @` 'dd'dp'dt'dx'd|( ("d@ƀ`T'dd㿘@@  @ &d&p&t&x&|*  (@" T&d㿘`@  @` &dd( (ᴐ  " @㿐@  @  @X @&d*  (@  " W WT&d㿐@  @  @X @&d*  (@  " W WT&d㿐@  @  @X @&d*` (@,0`" W ?W@T&d㿐@  @  @X @&d*  (@<@`" W W@T&d㿐@  @  @X @&d*  (@LP " W WT&d㿐@  @ &p&t &x&|@X @&d*  (@\`" W WT&d㿘`@  @` &dd@*  (dh <P(dx㿠` ``Pxv`Phf``1!@`P`@l   C* `aEdd@ddے;dd 6dd;1dd,dd'dd"ddCddsdddd>dd@ `!l '?dd'` `  @ @l &?@l &?㿠!p!l@!  @@   @" 㿠!p!l@!  @@  @     㿠"@2&@ &H L H㿠1!x!|@!@@!x,  (@! @@  @,  (@`@!x@ $@@@$@㿠l @@ 㿠  &  &  @ &   &  & 㿠& @& `` @ ?&(' ' (  @"?`& @   @` 㿠   ("&@ (& (&    @``* &㿠@@$@ @㿠@  &@  &@  &@  & @  &@  &@ & &  `   @ &``(   "   ( 㿠@(h"h@@h@&(@@hDhD&(D@hHhH&(H@hL&(LhL&(L$ |zd 㿠 @@`$  @$ `X h` " @" &  @*$d$$ $$X hd@" @" & $*@'h@@ 'hD@$'hH@$'hL㿠@ 1!@ " 4@!h'@@d!p'@!t'@!p!t'@d'@!t?@@ ``@?@d? 㿠 2  T @  T2 T @# ??  00? ( (  T 㿠   @ ` `0< @ @# #? 0@# '? 0@# ? (@#  (' `@# 0@# 0@# (@# ,' $`@# 0@# 0@# (@# ,' (`@# 0@# 0@# (@# ,' ,`@# 0@# @# 4`(@# (' 0  $ ( ,@ 0@@#   (4㿠 u# q# ? @ c  6`c6`B6`cl cx  @c  @ccL@ @ @ &cl@,@c 6`&`\@ cL@c(`cT@ @.`.`cl@@` @c @c @  㿠   @!:#(#$#b"##b5" ##b$"##b#2$ #$  $ $ $ @#"#@@' \## @'#' T#" ###@'#' t###\(@'#'#X㿠@@| ہ  Xh #l#p X  X X  X @  Tcb*cb5&cb$"cb#@`X? 0@`X? 0@`X? (@`X (@c @`X? 0@`X? 0@`X? (@`X (@c @`X @`XccH(`  㿠@ 㿠   @!4$ (,`@@ #H #D '  #\#H#D @ @  @#1& @ @<? ` @ @#\  ` @#@' X X@?@@    @@ ??@?@& 㿠   @" @#1&  "' X@ ' X' ?@& @@㿠   @"G @## (@2# (`#L @@ @ 㿠 ` ``( (@(@&`㿠&  @ ?* ` @ ?`` ` # & #& #\& @ ?㿘͔ @ 㿘 @* 2 㿘 @㿘.`6`@㿘@㿘 @㿘r @p#@ @# &##&#&##`6##b6##%%@  @      @& `$# ``"0b2 /$#Ȁ``"b) b"$$#b5" $#b$"$#b#2 $#Ȁ"$#b5"$#b$" $#b#2 $#Ȁ@"$#ȸ `  `&@@"2\#hT#lt#pX#t     n cȴ$"R#\k&#\`#` #d    @l T&T( R%@ =b b5  b$  b# #\ #\#d`#`    @p t&t( "%@  h`#` #d    @tX&@%@  ` &cȐ %  ؐ@X%@ ( (@(@ %@2@@@` 7   @@'@?   `  @#    @#    ؖ @#    `2b@2 @  @12b@2 @  @2bb b5  b$ b#2b @ @&   `(  ' ' @ ` @`@( @&%@`'@? @  @@ ` `#x``75 @$D` 75` @$E`  75`ؖ @$F`    ` @  %%$% @ 2@2 @ @ %% %1  ( x ` ` `  @`@&  @@"="7@ @  b5  b$ b#  b @2 @  @@ @  @%%  X   @! ~   Ȁ "@ # "@!a"T""X$ #'#+$"$% &"@ @ @ @ @ @ " "#@ @ y@ s@ m@ h@ b! " & "*S!! !"J@ H@ B@ =@ 7@ 1@ ,   "@ @ @ @  @  @@ @% 㿘    '       ' l @ @          㿘    '       '   @`@ 7`` 2` @`@ۄp'``!  @``@ ?` `   @` ` &` ` ``    㿘   '       ' 2 05$@$ @@$ @@$ @@$  @" @$ @@$ @@$ @@$  @ 0@$@ @@$D @@$8 @@$< @`"      '     '   @@ s` n`  @@ۄp `"k      " (    (   '$   ( '  1 @* 2` @ @* 2 @  @* 2` @ @* 2` @" $     ?    ?㿘   '       ' T @@ ?` :` @@ۄp  @@g%``&@&p`2&p` @p, @ @p  @`     㿠@ 㿘   '       ' >@, @`    㿘  '        ' , 1@  @ 8@ @h&h     㿘 `'``      ' ,$ @`@ @`  ``   㿘   '       ' %,$ @#`8@  @`8@, @`    㿘    '       '  X `@ @ `       㿘 `'``      '  X @ @`  ``   㿘    '       '   @`@ 7`` 2` @`@ۄp'``!  @``@ ?` `   @` ` &` ` ``    㿘   '       ' (?*@2`@ @ ր@  @@  @ @  @ @  @`"       '    ' 1!008 @ @ @ @ @' @  '   @㿘 `'``      ' x  @`  ``   㿘  '        '``  @ @  @ ' h ' h@ @ "        㿘@   ``' `     ' 0!0 @ @` @ @`  @`  @`  ``     㿘 `'` `    ` ' -`l @`@  @.S @` @ @`.Q   .P``    㿘 (` '`$`    `( ' ? @'  @` " ```$   `  `'``   ` '  ' * `       (``     @ I)`<`" `I` G`!E F "@`:>`;"= = G `<5`=3`F"2 2 G,`H"+ + ` `I!`J`"  ``"   ` ` `"    `  㿘 & O`" 02  0`" 0& 02``  &  # @& & 8 &$ @& , & `Ȁ"  0q`2 0`Ȑ ?@ ?`耠"  0  '`    02 P` @``` @`@262@464@666@868@:6:@<6<@>6>@@&@@D&D@H&H8( :(  @@#?  '     ' @%?DD @@ @@? @ : ( @"  H     H@"? <ฒ@ '``# @'`'`8 ' $ ` :! 0   00 8$  `*@& & `"`@$?  `'` `   ` ' 2 @%?`8`0 @` "  ``     `0& ` &'`,  I)`<`" `I` G`!E F "@`:>`;"= = G `<5`=3`F"2 2 G,`H"+ + ` `I!`J`"  ``"   ` ` `"    `  㿘 8    "+`  "4$`2&& 2&&(2&( &$2&4&0``& 8&,& 8Ȁ 'ȟ ?@ ?    ଀"ଟ  '     '`@%?  y* `@ @|    `    `@!? &' ,' ' ' 02 & ' E&&    7& ( " /  ' ܒ  (@(& ' ܒ  (@&& ' #  @' ' 8&$& ' ܒ  (@&&?' &  I)`<`" `I` G`!E F "@`:>`;"= = G `<5`=3`F"2 2 G,`H"+ + ` `I!`J`"  ``"   ` ` `"    `  4 TTTT44 4 TTTT @ TTTTT TTTT T TTTT㿠 O  yܞ*   8  @`@  @ " v  "+ o2m`  ``2` 52 &` ` &``&``T ` 2R`  ``"&``G `2F`  ` `"&``; `$  27 "& -`  ``2` 52 &` ` &``&`` ` `  ` `"&`` `$` ``"&`` ``*` @!? 0` ` ` ` ` ` ` ` ` `̄ ` `  `t `x `l ` ``    `|  ` 8  @!" ; 28 &`""-&` 2, &`""!&`  2 "  &`"" &` &`""&`* @!? 6`&`&`&`&`&`&`&`&`&`&`&` &`t&`x`  &`|&`|&`l&`&` Z.&`  6`&`&`&`&`&`&`&`&`&`&`&` &`t&`x&`|&`l&`&` &`  8(J       "      38       "   ` `   ` ` #$2  ` `$       ׆&6 64&(&< ` ##,##  @"?@!? I)`<`" `I` G`!E F "@`:>`;"= = G `<5`=3`F"2 2 G,`H"+ + ` `I!`J`"  ``"   ` ` `"    `  xppppxxxxxxxxxxxxxxxxxxxxppppxxxxxxxpppppxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxppppxxxxxxxxxxxxxpxpppp㿘``'` `    ` ' @%?`I=`l @`@*5` / @`@ۄb  @`@@2 `$@w`$ '`$` <8`  ' #g' @ W@ R`  `l @`@@*ސ` @ِ` `(@@`@SD    @`@ۄp ` @`@@  G <`$ '`$`8`  ' #' o` ` @'``!  @`@ ?    @`&` @'`ŀ  y)* `# `|1 `|  @  @`| @   @! 2&`!  @@ ?    @`&`@'`l@ \`  `l @`@*C` >`  Q@` @`@g   @`@@   <`$ '`$`8`  ' #' @ @@ "?    ?       㿠0G    @   * * `a"  㿠' @ 7`(/` 4" ?" " ," 㿠   ` L` & ` @#? 㿠`  & &`` &  &` ` &  &``?&  &`` `  ܔ `(@&  @ & & & ,&`&`$&`xl``P㿘    * `   Q` L` &    L & @".( (. (@ L@ .((`&`) @`$@$ @ @ L @$   ` L` & y@#t*` ( (  g @?b*  (`* ( (@ M@?H* ( (` * @&g "@* ` @] *@?%* ( (` ,J *  (`?`?&&, L&&  ,@&8@ @?*  (`"& 8 & 8@?*  (`* ( (@  ` L` & @? 8* @  (`& 8@?* ( (`*  (@`  `'` `   ` '@%8'`&8@`` @@"  ``     ' `' & &&,&0     7'  ( " /  &`ܒ  (@E'  &`ܒ  (@:' '  &# @&&8' $.'  &`ܒ  (@#' ' ?&' @?* ( (` *  (& 8& ,& 8& ,㿠  `  "` ("` 2` (."``h`@`h"` (`. L &`㿠. `x 2 ?  8((2 㿠`x??00?( (㿠. ?08((6 㿠??00?( (㿠6  1H@#D `@ @    @  @     @ @ 2 ?     _init ddi_soft_state_init failed _init mod_install failed Digi DataFire RAS/AccelePort Xp DGDXB driver (v. %s, %s) loaded. Copyright (C) 1998-2000 Digi International. All rights reserved. _fini status==%ld | Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456_info | Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456dgdxb_attach: DDI_ATTACH < DIGIras > instance too high, 0x%xremove pci114f entries from /etc/path_to_inst,reboot, and remove and re-install DIGIrasboard == NULL instance%d_use_interruptsdgdxb: unexpected vendor ID in dgdxb_attach(): 0x%04Xdgdxb: Digi %s (board %d, instance %d) dgdxb: Digi %s (board %d, instance %d) dgdxb: Digi %s (board %d, instance %d) dgdxb: Digi %s (board %d, instance %d) dgdxb: Digi %s (board %d, instance %d) dgdxb: Digi %s (board %d, instance %d) dgdxb: Digi %s (board %d, instance %d) dgdxb: Digi %s (board %d, instance %d) dgdxb: Digi %s (board %d, instance %d) dgdxb: Digi %s (board %d, instance %d) dgdxb: Digi %s (board %d, instance %d) dgdxb: Digi %s (board %d, instance %d) dgdxb: unknown subsystem ID in dgdxb_attach(): 0x%04Xdgdxb: Digi %s (board %d, instance %d) dgdxb: Digi %s (board %d, instance %d) dgdxb: Digi %s (board %d, instance %d) dgdxb: Digi %s (board %d, instance %d) dgdxb: Digi %s (board %d, instance %d) dgdxb: Digi %s (board %d, instance %d) dgdxb: Digi %s (board %d, instance %d) dgdxb: Digi %s (board %d, instance %d) dgdxb: unexpected subsys ID in dgdxb_attach(): 0x%04Xdgdxb: unexpected device ID in dgdxb_attach(): 0x%04X| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456dgdxb_dload_node_built=%d Making node %s (minor=%d) dgdxb: Could not build device node %s.Making node %s (minor=%d)... dgdxb: Could not build device node %s.%s%dMaking node %s (minor=%d)... dgdxb: Could not build device nodes.%s%dMaking node %s (minor=%d)... dgdxb: Could not build device nodes.dgdxb_attach: instance=%d, board=%lx instance%d_interrupt_perioddgdxb: Instance %d will operate in reduced-latency mode with an interrupt period of %d milliseconds. instance%d_altpindgdxb: Instance %d will operate in ALTPIN mode. dgdxb: dgdxb_attach faileddgdxb_attach: DDI_PM_RESUME dgdxb_attach: DDI_RESUME | Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456dgdxb_detach dgdxb_detach: ddi_get_soft_state==NULL,instance=%d dgdxb_detach: DDI_PM_SUSPEND dgdxb_detach: DDI_SUSPEND | Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456dgdxb: ddi_soft_state_zalloc() failed for instance %d.dgdxb: ddi_get_soft_state() returned NULL for instance %d.dgdxb: ddi_regs_map_setup() failed.What 'tis: %d %04X %04X %04X dgdxb: instance %d not recognized (vend/prod/sub=%04X/%04X/%04X)| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456dgdxb_open DIGIras: bad instance number requested dgdxb_open: mgmt=%lx DIGIras: dgdxb_open attempted on unattached adapter DIGIras: No management device with this minor. MGMT channel open DIGIras: No diagnostic device with this minor. DIAG GDB channel open DIAG PRINT channel open DIAG KME channel open DIGIras: Bad diag device number %x DIGIras: Bad minor device number %x DIGIras: could not open mgmt device because there are no free mgmt structures available DIGIras: dxb_open timed out DIGIras: open timed out | Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456dxb diag close succeeded dgdxb_close: destroy_saved_msg unsucessful dxb_close succeeded dgdxb_close: destroy_saved_msg unsucessful DIGIras: close timed out dgdxb: GETDD: mp is NULL dgdxb: GETDD: mblk has wrong size Gdgdxb: GETBD: mp is NULL dgdxb: GETBD: mblk_ptr has wrong size dgdxb: GETBD: invalid board dgdxb: GETSTAT: mp is NULL dgdxb: GETSTAT: mp->b_cont has wrong size dgdxb: GETSTAT ioctl: invalid board dgdxb: GETSTAT: asynbrdp->port is NULLdgdxb: GETSTAT: port[ds->info_chan][PORT_SERIAL] is NULL dgdxb: board_to_instance_ioctl: mblk_ptr->b_cont is NULL dgdxb: instance_to_board_ioctl: mblk_ptr->b_cont is NULL dgdxb error: instance_to_board_ioctl: board is NULL dgdxb error: get_board_pointer: invalid board number: %u dgdxb error: get_board_pointer: invalid instance number: %i dgdxb error: get_board_pointer: board is NULL dgdxb error: dump_queue_page: mblk_ptr->b_cont is NULL dgdxb error: dump_queue_page: bpsize(%d) < sizeof(%d) dgdxb error: dump_queue_page: no valid boards dgdxb: source_buffer=%x, dest_buffer=%x, transfer_size=%x dgdxb error: get_digiras_info: mblk_ptr->b_cont is NULL dgdxb error: get_digiras_info: bpsize(%d) < sizeof(%d) dgdxb error: get_digiras_info: invalid board dgdxb: mgmt ioctl not found in table dgdxb: IOCDATA ioctl: cmd: %x dgdxb: mp->b_cont is NULL: data_size:%x bpsize:%x dgdxb: mgmt ioctl not found dgdxb1: wptr:%x rptr:%x data size:%x dgdxb: PUTOUTDATA: dgdxb: M_IOCACK dgdxb: M_IOCNAK dgdxb: mgmt ioctl: cmd: %x dgdxb: info transparent ioctl: cmd:0x%x before send: send_buffer:%x recv_buffer:%x db_base:%x datasize:%x expect_len: %x send_len: %x dgdxb: wptr:%x rptr:%x data size:%x dgdxb: M_IOCTL: I_STR dgdxb: M_IOCACK dgdxb: M_IOCNAK Driver Part No.40002060-GDGDXB ver. GDGASY ver. Gdgdxb: M_PROTO b_rptr is NULL dgdxb: M_PROTO bpsize is too small: bpsize:%x PROTO: bpsize:%x ofset:%x dgdxb: M_PROTO: Message is not big enough: data_size: %x expected data_size: %x dgdxb: M_PROTO: Request for response packet size is too big: rpkt_len(%x) dgdxb: mgmt shim cmd:%x dgdxb: GET_MGMT_BOARD_NO failed: rpkt_len(%x) != sizeof(get_mgmt_board_no_response_t)(%x) dgdxb: GET_MGMT_BOARD_INFO failed: rpkt_len(%x) < sizeof(get_mgmt_board_info_response_t)(%x) dgdxb: GET_MGMT_BOARD_INFO failed: req_data_size(%x) < sizeof(get_mgmt_board_info_request)(%x) dgdxb: GET_MGMT_BOARD_INFO failed: error:%x dgdxb: GET_MGMT_SHIM_VER failed: req_data_size(%x) < sizeof(get_mgmt_board_info_request)(%x) dgdxb: GET_MGMT_DRV_VERS failed: req_data_size(%x) < sizeof(get_mgmt_board_info_request)(%x) dgdxb: MGMTSHIM: BAD COMMAND dgdxb: PROTO: MGMT: cmd:%x dgdxb: PROTO: mgmt ioctl not found: cmd:%x dgdxb: proto: data size mismatch: SEND: expect data size(%x) < actual data_size(%x) RECV: expect data size(%x) actual data size(%x) dgdxb: PROTO: mgmt ioctl failed: error =%i dgdxb: cmd:%x sent DIGIras: wput:FLUSHW DIGIras: wput:FLUSHR dgdxb: wput: M_IOCTL < wput: M_DATA > DIGIras wput: UNKNOWN message: type:%x DIGIras wput: exit q=%x | Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456dgdxb: kmem_alloc failed: dxb_malloc| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456dxb_alloc_page: Returning NULL dxb_alloc_page: Returning %08lX DIGIras alloc page return NULLdxb_alloc_page: Returning NULL DIGIras returning NULL translation for vaddr = %x | Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456%s| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456%s| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456DIGIras: ddi_dma_alloc_handle failed DIGIras: ddi_dma_mem_alloc failed DIGIras: ddi_dma_mem_alloc() returned too little DMA space DIGIras: ddi_dma_addr_bind_handle failed (%d) Digi RAS DMA segments=%d, physaddr=0x%x, size=0x%x DIGIras instance %d has %d segments at 0x%x | Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456DIGIras DMA allocate error!| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456DIGIras: ddi_dma_sync failed in dxb| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456DIGIras: ddi_dma_sync failed in dxbdgdxb_mgmt_ioctl_ack_cb chan=%d, cmd=0x%x, len=%d, err=%d dgdxb: mgmt_ioctl_cb: board is null dgdxb: mgmt_ioctl_cb: mgmt is closed dgdxb: mgmt_ioctl_cb: no saved message dgdxb: mgmt_ioctl_cb error | Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456dxb_DataCB no adapter dxb_dataCB: Bad data or No management opened !dxb_Data: Header Block allocation faileddxb_Data: Data Block allocation faileddxb_DataCB: management data lossdxb_DataCB: return (1)dgdxb_mgmt_ioctl_timeout: mgmt is NULL dgdxb_mgmt_ioctl_timout: mgmt is closed dgdxb_mgmt_ioctl_timeout: no saved message dgdxb cmd send: command:%x dgdxb_process_mgmt_ioctl: mgmt == NULL mgmt channel not functional mgmt channel closed dxb_write_ioctl_block(sendlen=%d) Actual mp size is not big enough for headerData Block allocation failedCONTINUE dgdxb_handle_ioctl | Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456DIGI_DLREQ_GET DIGI_DLREQ_SET DIGIras: unexpected ioctl in dgdxb_handle_download_ioctl() Downloading to instance %d... Firmware download success on instance %d. Firmware failed to download to instance %d. dgdxb: Heartbeat has stopped on instance %d.Adapter is off-line. dxb_data(%d, %d) dxb_cdata(%x, %d, %d, %d, %d) dxb_open(%x, %s, %d, (%d), %d) dxb_close(%x, %d) dxb_return_credits(%d, %d) dxb_return_fixed_cost(%d, %d) = %d dxb_ioctl(%d, 0x%04x, %d) dxb_ioctlack(%d, %d, %d, %d) dxb_push(%d, %s, %x, %d) Error: dxblib user has botched credits dxb_dxbuf_poll_one: no DATA_CB! dxb_dxdata_cb(%d, %d, %x) data[0] = 0x%x dxb_dxbuf_poll_one: no CDATA_CB! dxb_dxcdata_cb(%d, %d, %d, %x) ctrl[0] = 0x%x process_openack (%d) dxb_openack_cb(%d, %d, %d) process_closeack(%d) dxb_data_cb(%d, %d, %x) data[0] = 0x%x process_cdata process_credit %d credits process_pushack process_popack process_linkack process_unlinkack process_flushack process_ioctlack process_cancel dxb_rxpoll: q->in=%x dxb_rxpoll: q->out=%x Unknown DXB message 0x%x in=%x out=%x dxb_buf: page[0].virt = %x dxb_uninit: freeing resources dxb_set_phys: dxb=%x phys=%x dxb_init: dxb=%x, npages=%d pagesize=%d openside=%d | Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456%08X %08X %08X %08X %08XDIGIras: could not init null adapter| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456dgdxb: ddi_add_intr() failed on instance %d.Falling back to polling on this adapter. dgdxb_triboot() succeeded. (instance=%d) dgdxb_triboot() failed. (instance=%d) dgdxb_adapter_init OK! dgdxb: Firmware downloaded to board %d, instance %d. Adapter is ready for use. | Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456va of ghd=%08lX, ba of ghd=%08lX | Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456board->dma_vaddr=0x%08lX, board->dma_len=0x%08lX board->dxb=0x%08lX, board->dxb.h2a=0x%08lX, board->dxb.a2h=0x%08lX Error allocating memory during dxb_init! *** h2a=%lu a2h=%lu To get the DXB buffers for instance %d: dd if=/dev/kmem of=h2a.buf ibs=1 iseek=%lu count=%d dd if=/dev/kmem of=a2h.buf ibs=1 iseek=%lu count=%d dxbinterp_solaris h2a.buf > h2a.txt dxbinterp_solaris a2h.buf > a2h.txt Error allocating memory for ghd structure! dgdxb_host_dxb_init: board->dxb=%08lX testdxb=%08lX Error allocating memory for dxb structure! | Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456Got an interrupt! instance=%d DIGIras: dgdxb_get_ddi_acc_handle: bad instance number DIGIras: dgdxb_get_ddi_acc_handle: bad board pointer DIGIras: dgdxb_get_ddi_acc_handle: unknown memory type dgdxb: Could not map PCI registers on instance %d.dgdxb: ddi_regs_map_setup() failed.dgdxb: ddi_regs_map_setup() failed.dgdxb: ddi_regs_map_setup() failed.dgdxb: dgdxb_dxblib_init() failed.[%d](Downloading the POST...) (Downloading the FEP...) dgdxb: Firmware download to instance %d failed: No daemon?| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456rappost.binrappost.binrap2fep.binrap2fep.binhou2fep.binhou2fep.bindgdxb: Unexpected state/board combination (%d/%d/%d)%s %d DownloadGal9: no daemon. DownloadGal9: Got the DIGI_DLREQ_SET. | Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456| Assertion failed: %s | file: %s, line: %d | Please inform Digi Int'l Technical Support: | support@dgii.com, 1-612-912-3456DownloadGal9: Download failed. DownloadGal9: Download complete. (Running the POST...) (Running the FEP...) dgdxb: Unexpected triboot state: %ddgdxb: Error during firmware download to instance %d:Unspecified error (TRIBL_ERROR). Unspecified code error (TRIBL_CODE_ERROR). Incorrect version for this hardware. CRC check failed. Code too big. Header error. Unspecified early error (TRIBL_EARLY_ERROR). Memory error. Port error. Memory size error. Unspecified protocol error (TRIBL_PROTO_ERROR). Necessary BAR is missing. Ran out of devices. Attempted to use unregistered ID. Attempted to register a duplicate ID. No virtual addresses provided to TRIBL_MADDRS_DONE. A packet was received out of order. Unspecified unsupported-hardware error (TRIBL_UNSUPPORTED_HW). PCI vendor ID not supported. PCI device ID not supported. Initialization of DXB failed. BOOT error. POST error. FEP error. Other error (%d). x!4!8# " "$,%&` !4!8 $0$0AXA\B$a aab 8 LpT 0     xx0`   d`mgmtsnmptrace1_trace2_trace3_trace4_trace5_trace6_auxaauxbdxb Rdxb WDigi DGDXB driver (v. G)G32-bitdgdxb_dr_lockch_lockch_openclose_cvmodinfop!=NULL/export/home/dickl/sol_dense/dgdxb/dgdxb.cdip!=NULL/export/home/dickl/sol_dense/dgdxb/dgdxb.cdgdxb_board_cvAccelePort RAS 4AccelePort RAS 4AccelePort RAS 4AccelePort RAS 4AccelePort RAS 4AccelePort RAS 4AccelePort RAS 8AccelePort RAS 8AccelePort RAS 8AccelePort RAS 8AccelePort RAS 8AccelePort RAS 8AccelePort 2p PCIAccelePort 4p PCIAccelePort 8p PCIAccelePort 16p PCIAcceleport 32p PCIAcceleport 4p PCI EIA-232/422/485Acceleport 8p PCI EIA-232/422/485Acceleport 16p PCI EIA-232/422/485board->nports>0/export/home/dickl/sol_dense/dgdxb/dgdxb.cdownloadddi_pseudodload_startddi_pseudodgdxb_mgmtddi_pseudoddi_pseudo0/export/home/dickl/sol_dense/dgdxb/dgdxb.c0/export/home/dickl/sol_dense/dgdxb/dgdxb.cdip!=NULL/export/home/dickl/sol_dense/dgdxb/dgdxb.c0/export/home/dickl/sol_dense/dgdxb/dgdxb.c0/export/home/dickl/sol_dense/dgdxb/dgdxb.cdip!=NULL/export/home/dickl/sol_dense/dgdxb/dgdxb.cdxb!=NULL/export/home/dickl/sol_dense/dgdxb/dgdxb.cmgmt!=NULL/export/home/dickl/sol_dense/dgdxb/dgdxb.cmydxb!=NULL/export/home/dickl/sol_dense/dgdxb/dgdxb.cmgmt!=NULL/export/home/dickl/sol_dense/dgdxb/dgdxb.cq!=NULL/export/home/dickl/sol_dense/dgdxb/dgdxb.cMGMTq!=NULL/export/home/dickl/sol_dense/dgdxb/dgdxb.c0 && "dxb_malloc() called"/export/home/dickl/sol_dense/dgdxb/dgdxb.c0 && "dxb_free() called"/export/home/dickl/sol_dense/dgdxb/dgdxb.cfmt!=NULL/export/home/dickl/sol_dense/dgdxb/dgdxb.cstrlen(buf)b_datap->db_type==M_IOCTL/export/home/dickl/sol_dense/dgdxb/dgdxb.ciocbp!=NULL/export/home/dickl/sol_dense/dgdxb/dgdxb.cmgmtsnmptrace1_trace2_trace3_trace4_trace5_trace6_auxaauxbabcdefghijklmnopqrstuvwxyzABCDEFbrd!=NULL/export/home/dickl/sol_dense/dgdxb/adapinit.cboard!=NULL/export/home/dickl/sol_dense/dgdxb/adapinit.cgpd!=NULL/export/home/dickl/sol_dense/dgdxb/adapinit.cboard->dip!=NULL/export/home/dickl/sol_dense/dgdxb/adapinit.cdgdxb_board_lockboard!=NULL/export/home/dickl/sol_dense/dgdxb/adapinit.cboard!=NULL/export/home/dickl/sol_dense/dgdxb/adapinit.cboard!=NULL/export/home/dickl/sol_dense/dgdxb/adapinit.cboard!=NULL/export/home/dickl/sol_dense/dgdxb/adapinit.cdgdxb_req_get_mp!=NULL/export/home/dickl/sol_dense/dgdxb/adapinit.cdgdxb_req_get_mp->b_cont!=NULL/export/home/dickl/sol_dense/dgdxb/adapinit.cdgdxb_req_get_mp->b_cont->b_rptr!=NULL/export/home/dickl/sol_dense/dgdxb/adapinit.cdgdxb_req_set_mp!=NULL/export/home/dickl/sol_dense/dgdxb/adapinit.cdgdxb_req_set_mp->b_cont!=NULL/export/home/dickl/sol_dense/dgdxb/adapinit.cdgdxb_req_set_mp->b_cont->b_rptr!=NULL/export/home/dickl/sol_dense/dgdxb/adapinit.chlcb.binhlcp.binhlcf.bintiggerb.bintiggerp.bintiggerf.bins2kb.bins2kp.bins2kf.bin     08(E(dW Hdh,nx|  < P  9]DNeRp}1P-! 8+",TG-@a/ 12Y46(RhxٴXxX 2CXJUX\dp_x0 <Pb0l hh~@!4X?,,XdkH\u(b`0_( EX_4$  c8 1N Pa0 b k }   w  x  D Fx  n| x    2 Bz8 Qa0 c ix r       sD v$   {d ,GX :$  E M Z ` s x x,  l  b0     0 / : N hG ud 0  X,  J0  |4< T  z  $`X( 6I` E MP$ c oc    \   0  d X L ̘%+>L`uio٤T`(sLLe< #x/s9L~@0bids@LLHap08t{ 19Qx<Lv0UPe,s,8_(b0d@i0, b0"t@3kxGc,Wepd8}uta@0Lg$x(r$9LTjiq|8^,$T|4 #-CLT,eHoˠHf g4B*`09mD8KU|pdkh|ixh4d(Q<|$rtd"U /`0(C8<S\@rx}pDh a0/49LjTV`0fruFEX oFH0Ot2F Y n8$_( Dq _X %07PX>(JSYfmi}, f$b00`\`0  l 1 (94PLִ_/export/home/dickl/sol_dense/dgdxb/sparc/dgdxbdgdxb.cmgmtdev_namedgdxb_ioctl_tabledgdxb_cb_opsdgdxb_opsdgdxb_getinfodgdxb_identifydgdxb_probedgdxb_attachdgdxb_detachdgdxb_modldrvdgdxb_modlinkagedma_dev_attrdma_attrsdgdxb_dog_poller_iddgdxb_poller_iddgdxb_poller_runningdgdxb_dog_poller_runningdgdxb_downld_handlerdgdxb_find_mgmt_structdgdxb_mgmt_ioctl_ack_cbdgdxb_destroy_saved_msgblkdgdxb_handle_GETDD_ioctldgdxb_handle_GETBD_ioctldgdxb_get_board_pointerdgdxb_handle_GETSTAT_ioctldgdxb_handle_board_to_instance_ioctldgdxb_handle_instance_to_board_ioctldgdxb_dump_dxb_queue_pagedgdxb_handle_get_digiras_info_ioctldgdxb_get_mgmt_ioctl_infodgdxb_handle_IOCDATA_ioctldgdxb_send_mgmt_ioctldgdxb_handle_MIOCTL_ioctldgdxb_handle_GET_MGMT_BOARD_NO_ioctldgdxb_handle_GET_MGMT_BOARD_INFO_ioctldgdxb_handle_GET_MGMT_SHIM_VER_ioctldgdxb_handle_GET_MGMT_DRV_VERS_ioctldgdxb_handle_PROTO_ioctldgdxb_handle_download_ioctldgdxb_DxbPolldgdxb_restart_pollerdgdxb_restart_dog_pollerdgdxb_Fill_Controldgdxb_mgmt_ioctl_timeoutdxblib.crightmost_onefind_openmap_zerofind_openmap_limitsdxb_buf_vaddrdxb_data0clear_callbacksinit_rxbufuninit_rxbufinit_dxbufuninit_dxbufdxb_dxbuf_copy_from_bufcompute_dxbuf_areasprocess_openackprocess_closeackprocess_dataprocess_cdataprocess_creditprocess_pushackprocess_popackprocess_linkackprocess_unlinkackprocess_flushackprocess_ioctlackprocess_canceldxb_buf_allocdxb_buf_copyadapinit.cmgmtdev_namedgdxb_get_gc_ptrdgdxb_CompleteDeviceMapdgdxb_int_handlerdgdxb_tribootdgdxb_dxblib_destroydgdxb_dxblib_initdgdxb_host_dxb_initdgdxb_host_dxb_uninitdgdxb_get_ddi_acc_handledgtrace.c/export/home/dickl/sol_dense/triboot/sparc/triboot.ohlc_hw.cwant_intsrap_hw.cs2k_hw.ctb_dl.cis_s2ktb_mdone.cis_s2ktb_reg.chlc_binary_namesrap2_binary_namess2k_binary_namesis_s2ktb_wdone.cis_s2ktribl.ccrc32_tabledxb_set_open_cbddi_remove_intrgetminordxb_dxbuf_copyinhlc_postmapdxb_polldxb_set_ioctlack_cbbzeroddi_dma_addr_bind_handledxb_write_ctrl_blockrap_startdxb_rxbuf_flushhlc_post_board_intdgdxb_opendxb_dxbuf_data_locationshlc_mask_board_ints2k_resetdgdxb_ram_acc_attrddi_dma_mem_freedxb_set_ioctl_cbdxb_set_cdata_cbddi_dma_unbind_handles2k2_startdxb_mallocddi_dma_free_handledxb_set_credit_return_levelddi_getbdxb_set_syncdatadgdxb_translation_list_destroydxb_set_popack_cbddi_getldgdxb_board_countnbrdsqprocsoffddi_dma_nextcookiedxb_popddi_getwdxb_rxpoll_one_pagesizetribl_intrdxb_phys_page_sizecv_wait_sigdxb_write_donerap_clear_board_intdrv_infodxb_dxbuf_advancepci_config_getldxb_rxbuf_opendxb_set_unlink_cbfreebtri_bootddi_dma_alloc_handlemutex_entercv_destroydgdxb_adapter_destroys2k_unmask_board_intdxb_dxbuf_openddi_report_devdxb_data_credits_availdxb_unlinkbcopydgdxb_modldxb_rxbuf_getchardxb_free_pagedxb_uninitnulldevddi_rep_getbdelaydxb_global_rambasemutex_destroydxb_flushrap_shutdown_boardenableokdxb_peek_ctrl_writedxb_read_ctrl_blockdxb_set_cancelack_cb_pageoffsetddi_regs_map_setupddi_add_intrdgdxb_winfodgdxb_adapter_initmutex_exitddi_soft_state_freedxb_dxbuf_read_ctrl_blockdxb_virt2busclear_openmap_bitdgdxb_board_pollingdxb_dxbuf_ctrl_locationsdxb_read_data_blockdgdxb_allocate_dmaddi_soft_state_zallocdxb_rxbuf_count_infokmem_zallocdxb_rxbuf_copyindxb_set_credit_cbdgdxb_dbgerrorsprintfdxb_dma_sync_for_hostmod_installdxb_set_userdatapci_config_teardownputqnext_state_initdgdxb_req_set_mpcv_broadcastdgasy_module_idrap_resetdgdxb_translation_list_inithlc_unmask_board_intddi_dma_mem_alloc.umuldxb_global_galbasedxb_phys_copydxb_rxpoll_internaldxb_linknodevdgdxb_board_attacheds2k_shutdown_board.muldgdxb_infoqprocsondgdxb_OpenAckCBdxb_set_close_cbreturn_errorRDdxb_return_fixed_costhlc2_startdxb_swaplongLibdxbChandxb_initdgdxb_closedxb_ioctlddi_get_soft_statedxb_rxbuf_set_copyoutflushqhlc_resetdgdxb_pci_write16dgdxb_deallocate_dmaddi_getpropdxb_printfnochpolldxb_set_linkack_cbdgdxb_dog_poller_intervaldgdxb_pci_read32vsprintfdxb_peek_ctrl_readdxb_rxbuf_copyin_with_headercv_initdgdxb_start_pollerdxb_pushdxb_dxbuf_emptydxb_read_donedgdxb_pci_write32dxb_set_data_cbtb_registerpci_config_setupdxb_set_flush_cbddi_soft_state_finidgdxb_memcpy_to_pcidxb_queue_spaces2k_release_resetdxb_set_cancel_cbWRdgdxb_pci_read16dxb_peek_data_writeset_openmap_bitmod_driveropsget_gc_ptrdxb_set_physdgdxb_rinfodxb_cancelstrncpyddi_prop_opdgdxb_req_set_mutexkmem_allocrap_post_board_intddi_dma_syncdxb_set_link_cbtb_wait_donedxb_bytes_freeinit_crc32kmem_freedxb_credit_awards2k_mask_board_inttimeoutdxb_write_data_blockputnextrap2_startprintfdgdxb_dr_lockdgdxb_debugleveldxb_peek_data_readswap_le16dgdxb_dogdxb_dxbuf_locationsdgdxb_triboot_cbgetmajordxb_dxbuf_int_advancedgdxb_poller_intervaluntimeoutddi_get_iblock_cookiedxb_dxbbuf_parmsdgdxb_mgmt_tableswap_le32dgdxb_req_get_cvs2k_postmaphlc_clear_board_intdxb_rxpoll_allfreemsgdrv_usectohzdxb_copy_to_buf_syncddi_create_minor_nodedgdxb_translation_tableputbqdxb_copy_from_bufdgdxb_wputdxb_set_pop_cbdxb_peek_wconfirmhlc_startdxb_rxbuf_readallocbdxb_cdata_payload_spacedxb_datadxb_data_payload_spacedgdxb_winitdgdxb_req_get_mutexdgdxb_start_dog_pollerdxb_peek_rconfirmcv_timedwaitmod_infodxb_return_creditsdxb_ioctlackdgdxb_DataCBdxb_set_closeack_cbdgdxb_pci_read8ddi_putldgdxb_memcpy_from_pcilinkbgetqdxb_buf_freeddi_putwddi_rep_putbdxb_txpoll_allddi_get_instancedgdxb_downld_attemptsdgdxb_rsrvdxb_bytes_queueddrv_getparmdxb_set_unlinkack_cbmakedeviceLibdxbChanOffsets2k_startdxb_global_dmabasedxb_cdatadxb_set_push_cbdigi_tracefhzrap_postmapddi_regs_map_freerap_release_resetdxb_alloc_pagedgdxb_CloseAckCBdgdxb_wsrvcv_timedwait_sigtb_map_doneLibdxbDxbs2k_clear_board_intdxb_opendxb_freedxb_dma_sync_for_devddi_soft_state_inithlc_shutdown_boarddgdxb_alloc_instancedxb_dxbuf_read_data_blockdxb_txpoll_internaldgdxb_current_board_countPostdxb_set_openack_cb.udivswap16dgdxb_board_number_to_instance_tabledxb_closedxb_set_credit_cb_on_spacemod_removestrlenswap32dgdxb_rinitnoenableBoarddgdxb_statepqreplydxb_space_availdgdxb_req_get_mp_finidxb_copy_to_buf_no_syncdgdxb_freeing_instancedxb_set_flushack_cbcrc32get_d_info_indexcmn_errdxb_set_pushack_cbcanputnexttb_downloaddgdxb_req_set_cvramtestdxb_dxbuf_poll_ones2k_post_board_intmutex_init <h4 <i4 <k4 <j4M <i4M <i4M <i4K <h4Q <k4M <i4Q <k4K <h4cg: WorkShop Compilers 5.0 dev 28 Mar 1998 Build PUT_BUILDNUMBER_HERE@(#)dxb.c 1.17 98/12/09@(#)dxbus.h 1.2 94/07/27@(#)types.h 1.63 98/04/28 SMI@(#)isa_defs.h 1.15 97/11/22 SMI@(#)feature_tests.h 1.17 97/12/04 SMI@(#)machtypes.h 1.12 96/08/01 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)int_limits.h 1.5 98/01/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)types32.h 1.4 98/02/13 SMI@(#)select.h 1.16 98/04/27 SMI@(#)conf.h 1.57 98/01/06 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.19 98/04/14 SMI@(#)param.h 1.63 98/06/03 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)thread.h 1.89 98/06/07 SMI@(#)klwp.h 1.34 98/01/06 SMI@(#)condvar.h 1.10 98/02/18 SMI@(#)signal.h 1.53 98/06/30 SMI@(#)unistd.h 1.36 98/07/16 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.14 98/02/05 SMI@(#)time_impl.h 1.3 98/02/13 SMI@(#)pcb.h 1.30 98/01/06 SMI@(#)regset.h 1.23 98/03/09 SMI@(#)time.h 2.62 98/02/04 SMI@(#)msacct.h 1.7 93/07/13 SMI@(#)ucontext.h 1.25 97/09/28 SMI@(#)lwp.h 1.30 98/01/06 SMI@(#)synch.h 1.35 98/06/05 SMI@(#)systm.h 1.93 98/06/03 SMI@(#)proc.h 1.117 98/03/19 SMI@(#)cred.h 1.21 97/01/09 SMI@(#)user.h 1.56 98/06/30 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)model.h 1.20 97/09/22 SMI@(#)debug.h 1.22 97/05/15 SMI@(#)auxv.h 1.26 98/01/13 SMI@(#)errno.h 1.19 98/01/14 SMI@(#)timer.h 1.16 98/01/06 SMI@(#)watchpoint.h 1.6 98/01/06 SMI@(#)seg_enum.h 1.3 95/12/22 SMI@(#)copyops.h 1.3 97/07/07 SMI@(#)dditypes.h 1.26 98/03/04 SMI@(#)varargs.h 1.44 97/11/22 SMI@(#)va_list.h 1.11 97/11/22 SMI@(#)devops.h 1.37 98/01/06 SMI@(#)uio.h 1.29 97/06/29 SMI@(#)buf.h 1.43 98/07/14 SMI@(#)kstat.h 1.14 98/01/06 SMI@(#)poll.h 1.26 98/06/12 SMI@(#)as.h 1.68 98/06/04 SMI@(#)seg.h 1.54 98/05/25 SMI@(#)vnode.h 1.80 98/08/03 SMI@(#)faultcode.h 1.15 92/07/14 SMI@(#)hat.h 1.81 98/03/13 SMI@(#)page.h 1.112 98/06/29 SMI@(#)ddidmareq.h 1.25 98/01/24 SMI@(#)ddimapreq.h 1.14 96/06/25 SMI@(#)mman.h 1.36 98/06/04 SMI@(#)ddipropdefs.h 1.12 98/01/06 SMI@(#)ddidevmap.h 1.8 98/03/13 SMI@(#)nexusdefs.h 1.13 94/08/09 SMI@(#)aio_req.h 1.2 94/11/11 SMI@(#)file.h 1.56 98/07/28 SMI@(#)stropts.h 1.44 98/04/28 SMI@(#)stream.h 1.79 98/06/11 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)strlog.h 1.13 97/08/27 SMI@(#)kmem.h 1.26 98/01/06 SMI@(#)stat.h 1.45 98/03/24 SMI@(#)pci.h 1.19 98/01/22 SMI@(#)modctl.h 1.54 98/08/10 SMI@(#)ioccom.h 1.14 97/10/22 SMI@(#)strsun.h 1.15 98/04/28 SMI@(#)ddi.h 1.32 98/01/06 SMI@(#)map.h 1.23 98/02/25 SMI@(#)sunddi.h 1.90 98/06/29 SMI@(#)cmn_err.h 1.27 98/01/06 SMI@(#)ddi_implfuncs.h 1.21 98/01/06 SMI@(#)ddi_isa.h 1.6 97/04/09 SMI@(#)devctl.h 1.10 98/02/25 SMI@(#)limits.h 1.48 98/07/20 SMI@(#)termios.h 1.38 98/02/20 SMI@(#)ttydev.h 1.7 92/07/14 SMI@(#)stdigi.h 1.23 99/04/05$Header: /cvs_tick/sol_dense/include/stdigi.h,v 1.5 2000/02/16 16:00:09 emillan Exp $$Id: fepflags.h,v 1.2 1995/07/24 07:51:05 steveb Exp $@(#)dgaboard.h 1.0 1/29/98@(#)ser_sync.h 1.21 98/02/13 SMI@(#)stdigi.h 1.23 99/04/05$Header: /cvs_tick/sol_dense/include/stdigi.h,v 1.5 2000/02/16 16:00:09 emillan Exp $acomp: WorkShop Compilers 5.0 dev 28 Mar 1998 C 5.0 dev Build PUT_BUILDNUMBER_HEREcg: WorkShop Compilers 5.0 dev 28 Mar 1998 Build PUT_BUILDNUMBER_HERE@(#)types.h 1.63 98/04/28 SMI@(#)isa_defs.h 1.15 97/11/22 SMI@(#)feature_tests.h 1.17 97/12/04 SMI@(#)machtypes.h 1.12 96/08/01 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)int_limits.h 1.5 98/01/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)types32.h 1.4 98/02/13 SMI@(#)select.h 1.16 98/04/27 SMI@(#)sunddi.h 1.90 98/06/29 SMI@(#)dditypes.h 1.26 98/03/04 SMI@(#)ddipropdefs.h 1.12 98/01/06 SMI@(#)devops.h 1.37 98/01/06 SMI@(#)cred.h 1.21 97/01/09 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.19 98/04/14 SMI@(#)param.h 1.63 98/06/03 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)thread.h 1.89 98/06/07 SMI@(#)klwp.h 1.34 98/01/06 SMI@(#)condvar.h 1.10 98/02/18 SMI@(#)signal.h 1.53 98/06/30 SMI@(#)unistd.h 1.36 98/07/16 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.14 98/02/05 SMI@(#)time_impl.h 1.3 98/02/13 SMI@(#)pcb.h 1.30 98/01/06 SMI@(#)regset.h 1.23 98/03/09 SMI@(#)time.h 2.62 98/02/04 SMI@(#)msacct.h 1.7 93/07/13 SMI@(#)ucontext.h 1.25 97/09/28 SMI@(#)lwp.h 1.30 98/01/06 SMI@(#)synch.h 1.35 98/06/05 SMI@(#)uio.h 1.29 97/06/29 SMI@(#)buf.h 1.43 98/07/14 SMI@(#)kstat.h 1.14 98/01/06 SMI@(#)poll.h 1.26 98/06/12 SMI@(#)as.h 1.68 98/06/04 SMI@(#)watchpoint.h 1.6 98/01/06 SMI@(#)seg_enum.h 1.3 95/12/22 SMI@(#)copyops.h 1.3 97/07/07 SMI@(#)seg.h 1.54 98/05/25 SMI@(#)vnode.h 1.80 98/08/03 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)model.h 1.20 97/09/22 SMI@(#)debug.h 1.22 97/05/15 SMI@(#)faultcode.h 1.15 92/07/14 SMI@(#)hat.h 1.81 98/03/13 SMI@(#)page.h 1.112 98/06/29 SMI@(#)ddidmareq.h 1.25 98/01/24 SMI@(#)ddimapreq.h 1.14 96/06/25 SMI@(#)mman.h 1.36 98/06/04 SMI@(#)ddidevmap.h 1.8 98/03/13 SMI@(#)nexusdefs.h 1.13 94/08/09 SMI@(#)aio_req.h 1.2 94/11/11 SMI@(#)cmn_err.h 1.27 98/01/06 SMI@(#)va_list.h 1.11 97/11/22 SMI@(#)ddi_implfuncs.h 1.21 98/01/06 SMI@(#)ddi_isa.h 1.6 97/04/09 SMI@(#)devctl.h 1.10 98/02/25 SMI@(#)ddi.h 1.32 98/01/06 SMI@(#)map.h 1.23 98/02/25 SMI@(#)stream.h 1.79 98/06/11 SMI@(#)strmdep.h 1.10 98/01/06 SMIacomp: WorkShop Compilers 5.0 dev 28 Mar 1998 C 5.0 dev Build PUT_BUILDNUMBER_HEREcg: WorkShop Compilers 5.0 dev 28 Mar 1998 Build PUT_BUILDNUMBER_HERE@(#)dxbus.h 1.2 94/07/27@(#)types.h 1.63 98/04/28 SMI@(#)isa_defs.h 1.15 97/11/22 SMI@(#)feature_tests.h 1.17 97/12/04 SMI@(#)machtypes.h 1.12 96/08/01 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)int_limits.h 1.5 98/01/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)types32.h 1.4 98/02/13 SMI@(#)select.h 1.16 98/04/27 SMI@(#)conf.h 1.57 98/01/06 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.19 98/04/14 SMI@(#)param.h 1.63 98/06/03 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)thread.h 1.89 98/06/07 SMI@(#)klwp.h 1.34 98/01/06 SMI@(#)condvar.h 1.10 98/02/18 SMI@(#)signal.h 1.53 98/06/30 SMI@(#)unistd.h 1.36 98/07/16 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.14 98/02/05 SMI@(#)time_impl.h 1.3 98/02/13 SMI@(#)pcb.h 1.30 98/01/06 SMI@(#)regset.h 1.23 98/03/09 SMI@(#)time.h 2.62 98/02/04 SMI@(#)msacct.h 1.7 93/07/13 SMI@(#)ucontext.h 1.25 97/09/28 SMI@(#)lwp.h 1.30 98/01/06 SMI@(#)synch.h 1.35 98/06/05 SMI@(#)systm.h 1.93 98/06/03 SMI@(#)proc.h 1.117 98/03/19 SMI@(#)cred.h 1.21 97/01/09 SMI@(#)user.h 1.56 98/06/30 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)model.h 1.20 97/09/22 SMI@(#)debug.h 1.22 97/05/15 SMI@(#)auxv.h 1.26 98/01/13 SMI@(#)errno.h 1.19 98/01/14 SMI@(#)timer.h 1.16 98/01/06 SMI@(#)watchpoint.h 1.6 98/01/06 SMI@(#)seg_enum.h 1.3 95/12/22 SMI@(#)copyops.h 1.3 97/07/07 SMI@(#)dditypes.h 1.26 98/03/04 SMI@(#)varargs.h 1.44 97/11/22 SMI@(#)va_list.h 1.11 97/11/22 SMI@(#)devops.h 1.37 98/01/06 SMI@(#)uio.h 1.29 97/06/29 SMI@(#)buf.h 1.43 98/07/14 SMI@(#)kstat.h 1.14 98/01/06 SMI@(#)poll.h 1.26 98/06/12 SMI@(#)as.h 1.68 98/06/04 SMI@(#)seg.h 1.54 98/05/25 SMI@(#)vnode.h 1.80 98/08/03 SMI@(#)faultcode.h 1.15 92/07/14 SMI@(#)hat.h 1.81 98/03/13 SMI@(#)page.h 1.112 98/06/29 SMI@(#)ddidmareq.h 1.25 98/01/24 SMI@(#)ddimapreq.h 1.14 96/06/25 SMI@(#)mman.h 1.36 98/06/04 SMI@(#)ddipropdefs.h 1.12 98/01/06 SMI@(#)ddidevmap.h 1.8 98/03/13 SMI@(#)nexusdefs.h 1.13 94/08/09 SMI@(#)aio_req.h 1.2 94/11/11 SMI@(#)file.h 1.56 98/07/28 SMI@(#)stropts.h 1.44 98/04/28 SMI@(#)stream.h 1.79 98/06/11 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)strlog.h 1.13 97/08/27 SMI@(#)kmem.h 1.26 98/01/06 SMI@(#)stat.h 1.45 98/03/24 SMI@(#)pci.h 1.19 98/01/22 SMI@(#)modctl.h 1.54 98/08/10 SMI@(#)ioccom.h 1.14 97/10/22 SMI@(#)strsun.h 1.15 98/04/28 SMI@(#)ddi.h 1.32 98/01/06 SMI@(#)map.h 1.23 98/02/25 SMI@(#)sunddi.h 1.90 98/06/29 SMI@(#)cmn_err.h 1.27 98/01/06 SMI@(#)ddi_implfuncs.h 1.21 98/01/06 SMI@(#)ddi_isa.h 1.6 97/04/09 SMI@(#)devctl.h 1.10 98/02/25 SMI@(#)limits.h 1.48 98/07/20 SMIacomp: WorkShop Compilers 5.0 dev 28 Mar 1998 C 5.0 dev Build PUT_BUILDNUMBER_HEREcg: WorkShop Compilers 5.0 dev 28 Mar 1998 Build PUT_BUILDNUMBER_HERE@(#)varargs.h 1.44 97/11/22 SMI@(#)va_list.h 1.11 97/11/22 SMI@(#)ddi.h 1.32 98/01/06 SMI@(#)types.h 1.63 98/04/28 SMI@(#)isa_defs.h 1.15 97/11/22 SMI@(#)feature_tests.h 1.17 97/12/04 SMI@(#)machtypes.h 1.12 96/08/01 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)int_limits.h 1.5 98/01/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)types32.h 1.4 98/02/13 SMI@(#)select.h 1.16 98/04/27 SMI@(#)map.h 1.23 98/02/25 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.19 98/04/14 SMI@(#)param.h 1.63 98/06/03 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)thread.h 1.89 98/06/07 SMI@(#)klwp.h 1.34 98/01/06 SMI@(#)condvar.h 1.10 98/02/18 SMI@(#)signal.h 1.53 98/06/30 SMI@(#)unistd.h 1.36 98/07/16 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.14 98/02/05 SMI@(#)time_impl.h 1.3 98/02/13 SMI@(#)pcb.h 1.30 98/01/06 SMI@(#)regset.h 1.23 98/03/09 SMI@(#)time.h 2.62 98/02/04 SMI@(#)msacct.h 1.7 93/07/13 SMI@(#)ucontext.h 1.25 97/09/28 SMI@(#)lwp.h 1.30 98/01/06 SMI@(#)synch.h 1.35 98/06/05 SMI@(#)buf.h 1.43 98/07/14 SMI@(#)kstat.h 1.14 98/01/06 SMI@(#)uio.h 1.29 97/06/29 SMI@(#)stream.h 1.79 98/06/11 SMI@(#)vnode.h 1.80 98/08/03 SMI@(#)cred.h 1.21 97/01/09 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)model.h 1.20 97/09/22 SMI@(#)debug.h 1.22 97/05/15 SMI@(#)seg_enum.h 1.3 95/12/22 SMI@(#)poll.h 1.26 98/06/12 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)sunddi.h 1.90 98/06/29 SMI@(#)dditypes.h 1.26 98/03/04 SMI@(#)ddipropdefs.h 1.12 98/01/06 SMI@(#)devops.h 1.37 98/01/06 SMI@(#)as.h 1.68 98/06/04 SMI@(#)watchpoint.h 1.6 98/01/06 SMI@(#)copyops.h 1.3 97/07/07 SMI@(#)seg.h 1.54 98/05/25 SMI@(#)faultcode.h 1.15 92/07/14 SMI@(#)hat.h 1.81 98/03/13 SMI@(#)page.h 1.112 98/06/29 SMI@(#)ddidmareq.h 1.25 98/01/24 SMI@(#)ddimapreq.h 1.14 96/06/25 SMI@(#)mman.h 1.36 98/06/04 SMI@(#)ddidevmap.h 1.8 98/03/13 SMI@(#)nexusdefs.h 1.13 94/08/09 SMI@(#)aio_req.h 1.2 94/11/11 SMI@(#)cmn_err.h 1.27 98/01/06 SMI@(#)ddi_implfuncs.h 1.21 98/01/06 SMI@(#)ddi_isa.h 1.6 97/04/09 SMI@(#)devctl.h 1.10 98/02/25 SMI@(#)ksynch.h 1.6 97/10/22 SMIacomp: WorkShop Compilers 5.0 dev 28 Mar 1998 C 5.0 dev Build PUT_BUILDNUMBER_HEREcg: WorkShop Compilers 5.0 dev 28 Mar 1998 Build PUT_BUILDNUMBER_HERE@(#)types.h 1.63 98/04/28 SMI@(#)isa_defs.h 1.15 97/11/22 SMI@(#)feature_tests.h 1.17 97/12/04 SMI@(#)machtypes.h 1.12 96/08/01 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)int_limits.h 1.5 98/01/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)types32.h 1.4 98/02/13 SMI@(#)select.h 1.16 98/04/27 SMIacomp: WorkShop Compilers 5.0 dev 28 Mar 1998 C 5.0 dev Build PUT_BUILDNUMBER_HEREcg: WorkShop Compilers 5.0 dev 28 Mar 1998 Build PUT_BUILDNUMBER_HERE@(#)types.h 1.63 98/04/28 SMI@(#)isa_defs.h 1.15 97/11/22 SMI@(#)feature_tests.h 1.17 97/12/04 SMI@(#)machtypes.h 1.12 96/08/01 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)int_limits.h 1.5 98/01/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)types32.h 1.4 98/02/13 SMI@(#)select.h 1.16 98/04/27 SMIacomp: WorkShop Compilers 5.0 dev 28 Mar 1998 C 5.0 dev Build PUT_BUILDNUMBER_HEREcg: WorkShop Compilers 5.0 dev 28 Mar 1998 Build PUT_BUILDNUMBER_HERE@(#)types.h 1.63 98/04/28 SMI@(#)isa_defs.h 1.15 97/11/22 SMI@(#)feature_tests.h 1.17 97/12/04 SMI@(#)machtypes.h 1.12 96/08/01 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)int_limits.h 1.5 98/01/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)types32.h 1.4 98/02/13 SMI@(#)select.h 1.16 98/04/27 SMIacomp: WorkShop Compilers 5.0 dev 28 Mar 1998 C 5.0 dev Build PUT_BUILDNUMBER_HEREcg: WorkShop Compilers 5.0 dev 28 Mar 1998 Build PUT_BUILDNUMBER_HERE@(#)types.h 1.63 98/04/28 SMI@(#)isa_defs.h 1.15 97/11/22 SMI@(#)feature_tests.h 1.17 97/12/04 SMI@(#)machtypes.h 1.12 96/08/01 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)int_limits.h 1.5 98/01/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)types32.h 1.4 98/02/13 SMI@(#)select.h 1.16 98/04/27 SMIacomp: WorkShop Compilers 5.0 dev 28 Mar 1998 C 5.0 dev Build PUT_BUILDNUMBER_HEREcg: WorkShop Compilers 5.0 dev 28 Mar 1998 Build PUT_BUILDNUMBER_HERE@(#)types.h 1.63 98/04/28 SMI@(#)isa_defs.h 1.15 97/11/22 SMI@(#)feature_tests.h 1.17 97/12/04 SMI@(#)machtypes.h 1.12 96/08/01 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)int_limits.h 1.5 98/01/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)types32.h 1.4 98/02/13 SMI@(#)select.h 1.16 98/04/27 SMIacomp: WorkShop Compilers 5.0 dev 28 Mar 1998 C 5.0 dev Build PUT_BUILDNUMBER_HEREcg: WorkShop Compilers 5.0 dev 28 Mar 1998 Build PUT_BUILDNUMBER_HERE@(#)types.h 1.63 98/04/28 SMI@(#)isa_defs.h 1.15 97/11/22 SMI@(#)feature_tests.h 1.17 97/12/04 SMI@(#)machtypes.h 1.12 96/08/01 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)int_limits.h 1.5 98/01/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)types32.h 1.4 98/02/13 SMI@(#)select.h 1.16 98/04/27 SMIacomp: WorkShop Compilers 5.0 dev 28 Mar 1998 C 5.0 dev Build PUT_BUILDNUMBER_HEREcg: WorkShop Compilers 5.0 dev 28 Mar 1998 Build PUT_BUILDNUMBER_HERE@(#)types.h 1.63 98/04/28 SMI@(#)isa_defs.h 1.15 97/11/22 SMI@(#)feature_tests.h 1.17 97/12/04 SMI@(#)machtypes.h 1.12 96/08/01 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)int_limits.h 1.5 98/01/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)types32.h 1.4 98/02/13 SMI@(#)select.h 1.16 98/04/27 SMIacomp: WorkShop Compilers 5.0 dev 28 Mar 1998 C 5.0 dev Build PUT_BUILDNUMBER_HEREcg: WorkShop Compilers 5.0 dev 28 Mar 1998 Build PUT_BUILDNUMBER_HERE@(#)types.h 1.63 98/04/28 SMI@(#)isa_defs.h 1.15 97/11/22 SMI@(#)feature_tests.h 1.17 97/12/04 SMI@(#)machtypes.h 1.12 96/08/01 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)int_limits.h 1.5 98/01/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)types32.h 1.4 98/02/13 SMI@(#)select.h 1.16 98/04/27 SMIacomp: WorkShop Compilers 5.0 dev 28 Mar 1998 C 5.0 dev Build PUT_BUILDNUMBER_HERE.text.rodata1.rodata.plt.data.data1.bss.symtab.strtab.stab.index.comment.shstrtab.rela.text.rela.data.stab.indexstrZ X  d 4R P dR PZ X  Rp Rp 4 , 4  4  4  4  0 4V 8J J J J Jt R$ R  1 (R4 V 8Q Q Q Q Q ( $ Q Q Jl   1 (1 (W 8W 8W 8Vl 8V` 8VX 8V 8Q Jx Rd R` R8 UL UH  [ [ [   [ \$ X\( X\p \t  Pl d Ph dP@ ,P< ,O O O O  | |N   N  M L Ll Lh      $ 0 0  H l  F E D   ` $JH JD T  Ix \ Ih H H F` hF\ hFX LFT LF  F   d    x  x P l  `@    < , \ l    t p  x  x4 8 0 \L d l      8 D D  l l @   ( ,  8L P d p  t    4 4p $ \ \l $  ` @  8 8 < 4 ` d  x  t   4 4PD + \ \P +l  O *    O * @  D  | h  l O *4  $  $N )  L  LN )    0 4 N\ )|    M (M (0 l @  H M (DM (D    1X      1\ 0l     0h   2 8  (  (0D 0@ 0 l 0 0 4 0/ l2 8/ 2  p P t P/   / 5 X  x  x5 X    5, 50 , T5     5p 5 6T 6 ,  4  < - ,  t x 6 ,  H  HO *4  x  x- 7    9d X,h l    ,d l   t  t9h X 0 9  @ D 9 + 0+ 0;  + \< + + < +X +T <8  " "  ^ 44^ 44^ 4^ 45 L4 'x] 3] 3] 3] 3  ] 3   ] 3 ] 3<] 3<.l 0X P\ P.h 0t x \ 3, l l\ 3,\ 3L\ 3L\| 2  \x 2\0 1\, 1[ 1X[ 1X[ 0[ 0[ 0[ 0[X 0[T 0[H 0|[D 0|[@ 0[ 0P[ 0PZt 0,Zp 0,Y 0Y 0 0Y / 0 PY / PYp /  Yl /L, 'x< TIH $  Y< /Y8 /Xl /Xh /XH /XXD /XX /0X @\ @X /0W /W / x xW .pW .p  Wd .W` .I $GL "0 < VD .V@ .p   U .U .U .pU .pUx .XUt .XUD -U@ -TT -TP -t <x <T -  S4 -xS0 -xR -PR -PR -(R -( t tR| ,@ D Rt ,<<  ! x! xP ,P ,  Pt ,, H HPp ,,PH +GD "0 T.< 5 P  +l. .   |F4 !- D !D5 - N` )|D !DD| !-t \-p \Dt !DD` !D6X DH !! \    Ld '  L` '4 8 DD !C !DK 'DK 'DC !DC K 'K 'K< &K8 &K  &K &J &J &JP %JL %J %J %I %I %PI %P 4 4C B \I $I $IL $8 TB\ \  ! \H $H $=   t <H #xH #xHx #DHt #D6 -   p <=  G8 #$G0 #$G$ #G  "G "F #  F #   @ @F " X X-  t t6 ,FP "$FL "$ L F0 !E !`E !` H = 0D !    =$ 0  D@ !DD0 !DD  !DC C0 =0 <=8 <=H HC| Cx @  p pB |B |B \ ? @BX  `  B< B8 B B A( A$ A A @ @ 0 T T@| 0@8 @4 ? @  ? @> h l l? >\ ?D ?@ ?0 ?  ? ` d > h>( >`   (>, = = =x X$ (=t X=d L=\ L\ ` =P H   ^H ^D I7 K7 K7 WP7 H7 H7 I7 WL7 T L d t | ( $ F F    G\ G` \ , ( 8 0 p l     \   ` < 8       \   , 4      ]$ ] | x D 4 $ t p    ]( P ]0 H <& L& & & & & ]& ]& & & \E \E 0E 8E xE |E <Z Z $Z Z 4Z Z Z Z Z Z (Z \Z \Z Z Z `Z dZ , ,( ,$   -8 < , -@ $  0      m m ]Hm ]Lm , -\ -`  ( ,  ]P , ]T L P 8 4 ]` ^L ^P ]X  P X  ( P   T   RH RL R? ? ? R ?   X\|d 4TXD[5Z|6\5YL1`<@8DL<  C,A6CL<C RLt5/54B@$4@IG(L|<I/I,KB0HNFhxNdJ`\K@HD OF8K/B0pF.JM(HOBh$0OY?[LP`$4PX HP 8 $P<[B @|+\ (L    x^^@Tt  P[\!<A0 |(h"tl-T, U| Rd?,RS<  , <-x(h T]<,Y\+l|[ $Xp@U`+ >8?P+-(>hU@L xVH,@XL\ <WPYtl@D Wh,l\X \DdWhPdp,    JJJ<J\JPJJJJ4JY\X0WWpW VYUTHTSSSRLLQ|Q4Q8P tU]H\|^D ^< d(dZDZZ$80Y,WXxW4@TVVZ8XT(Vh\V@UU ]4T@pTS4HS S\RxQ4Q_`Qp_,QLL\Xx h@S@L@@@Ax \l,^_ _W_s_W,_IPxHxdxxPxxx xxG4xxxJ xGHxGxKxxxxxl4ll`x   @p  X 0sptsDwHjqtX,tjx< `L L tL L xHP({d{T{<{|| | yy yd ` p],\ ~ (~ Z4TSYYxZzLpDdDpp$pp a a },r$=xT<0b=T$=$$=($=l$=$=@$MD/ O ./N. }}|fh|f }g(`/L0 0 811T[$2LTXX995ICIBI5I5XI5tI1I2I6,IDTIDI8DIEI6HIWDI2I2XIUU8TU>UV0U8U[0UAf@fVfE\gEgDgEgCpCCTD4DhD$SYW333D3E3VEE8N~~y<yhF'z~y|z$OP.Fp.F| F Jp O Jh O M< M8 M4 Th}<}D}G G |pd<X|T4I I oIvI4IJ JJKxuLdTdLddhLLL|MMNl`t~~~~~ۤ~~l~~|~~Od~,~~4~@~vu|rpvxpq`y rg nwP)O) |Q@|^| [Z1RX1R1RP: RT: T0VWST8WSVظܤD h TlXD  l$ `,ʘ\l,lt@<dŀŠL҄ϔ,LSUZ<Y$WWZy Zy z z Y|  t   l  d    t x `   h d p  w4p8ZZ\Z2], 4 t 5L| 5L 5t 5 5 5 5  58 6 5 60L 6LT 6Lh 6d4 6l 6d 6 60 6v 50v 50 6@ 6D 6 6 6 6 6 6 6 7 7| 7 7t 5t| 5 6t 4s 4s 4sx 4s 4s 44 7, 7T( 7,0 74 7l@ 7lq 4q 4 7T 7T 7< 7<x 7| 7o 4o 4( 7h 7i 4Ll 7 7j 4`jp 4` 7i 4L 5ts s   ` px0|\\qKrtKtPKtKpKwKwKq<KxXKuKxKvKlTKkKjKj@KudKqKwtKOOOPOOOOODOODO{OOOOO(OOOOOOOdO|O8OdO O{lO{(OO\Ox,x,vT,u,u,,r8,q,i,h,hD,i@,(Xs<//sl P;|;,`H|kB4h<h@$! p p  < H  8 84 0 T HP H X X      ` Td T         J Hx  Hx  H8 Jd Bdl J Bd4 Jd HPt J BH H D BH ID B@ J J ID J J HP JT B< JD JH Ix H J` J$d J$ Ax J A H$ H$ A H` A J J A A B@ I` J E E E4 E4 I` B H Hh B B Ix E4 E\ E\h G` GL Gt8 ED Gt( GP$ GP@ E G0 G0 F Ix| Hd H CXP I H H CX< I@ G8 I$ I  I J I J H J H H Jx HX C4 G0 G D\ C G D D B B D D D D  D D D( EL I$ E  D D D FH ;8< ;8 ;  : ;d ;d ;  :h ;p ; :@0 G( G\ >< :` <d <l :@T A|P A| ?| : ;  < <L ;8d =T AD AD A  A  @ @ 9` @ @ ; ; @ @h :@ ?|l =TL : = ?P 9` ?P ?Px ?t ? 8 8 = 8( = =, > 9 9 8(0 >T >xu u hP8$8\p55X5,< $< ccP@À`$, XӐ||D0 DɌЄנp@ȴȐi$jeeeeиeTeeôe@l]\] < <               8          { { \ ` ٬       $ (  \  `          <   L    4 H ( Մx t ` X |tdި\tߜHdD  8L`$d0`,\     , |( x( +8-4 4 Ȝ9x9`9(9ɔDDD8DDDDD\DDLDDD`DxDЌDרDLDDDDPDDDʀDD܈DhDDÈDHD D|F xF hG lG S S lt pt P L     ܴ048XHl(TX8ŌπpP0 Ŭ@4D $dL8P< D @ t<|xp h$H  (PX`08 @"nYPT $D@0H<84,(LP% @\ ` d l p t x | $ ( , 0 4 8 <X  D H L P T X \ ` d h lh  p t x |  T L H D @ P <   htdgdxb.cXa ; O ; V=3.1 ; R=WorkShop Compilers 5.0 dev 28 Mar 1998 C 5.0 dev Build PUT_BUILDNUMBER_HERE/export/home/dickl/sol_dense; /usr/bintools/cc -O -DSOLARIS -Dsparc -erroff=E_WHITE_SPACE_IN_DIRECTIVE -xCC -DSOLARIS7 -I/export/home/dickl/sol_dense/include -I/export/home/dickl/sol_dense/release/fepincl -I/export/home/dickl/sol_dense/libdxb -I/export/home/dickl/sol_dense/triboot -D_KERNEL -I/export/home/dickl/sol_dense/include -I/export/home/dickl/sol_dense/release/fepincl -I/export/home/dickl/sol_dense/libdxb -I/export/home/dickl/sol_dense/triboot -c -o /export/home/dickl/sol_dense/dgdxb/sparc/dgdxb.o /export/home/dickl/sol_dense/dgdxb/dgdxb.c -W0,-xpdxblib.cXa ; O ; V=3.1 ; R=WorkShop Compilers 5.0 dev 28 Mar 1998 C 5.0 dev Build PUT_BUILDNUMBER_HERE/export/home/dickl/sol_dense; /usr/bintools/cc -O -DSOLARIS -Dsparc -erroff=E_WHITE_SPACE_IN_DIRECTIVE -xCC -DSOLARIS7 -I/export/home/dickl/sol_dense/include -I/export/home/dickl/sol_dense/release/fepincl -I/export/home/dickl/sol_dense/libdxb -I/export/home/dickl/sol_dense/triboot -D_KERNEL -I/export/home/dickl/sol_dense/include -I/export/home/dickl/sol_dense/release/fepincl -I/export/home/dickl/sol_dense/libdxb -I/export/home/dickl/sol_dense/triboot -DDXB_HOST -c -o /export/home/dickl/sol_dense/dgdxb/sparc/dxblib.o /export/home/dickl/sol_dense/libdxb/dxblib.c -W0,-xpadapinit.cXa ; O ; V=3.1 ; R=WorkShop Compilers 5.0 dev 28 Mar 1998 C 5.0 dev Build PUT_BUILDNUMBER_HERE/export/home/dickl/sol_dense; /usr/bintools/cc -O -DSOLARIS -Dsparc -erroff=E_WHITE_SPACE_IN_DIRECTIVE -xCC -DSOLARIS7 -I/export/home/dickl/sol_dense/include -I/export/home/dickl/sol_dense/release/fepincl -I/export/home/dickl/sol_dense/libdxb -I/export/home/dickl/sol_dense/triboot -D_KERNEL -I/export/home/dickl/sol_dense/include -I/export/home/dickl/sol_dense/release/fepincl -I/export/home/dickl/sol_dense/libdxb -I/export/home/dickl/sol_dense/triboot -c -o /export/home/dickl/sol_dense/dgdxb/sparc/adapinit.o /export/home/dickl/sol_dense/dgdxb/adapinit.c -W0,-xpdgtrace.cXa ; O ; V=3.1 ; R=WorkShop Compilers 5.0 dev 28 Mar 1998 C 5.0 dev Build PUT_BUILDNUMBER_HERE/export/home/dickl/sol_dense; /usr/bintools/cc -O -DSOLARIS -Dsparc -erroff=E_WHITE_SPACE_IN_DIRECTIVE -xCC -DSOLARIS7 -I/export/home/dickl/sol_dense/include -I/export/home/dickl/sol_dense/release/fepincl -I/export/home/dickl/sol_dense/libdxb -I/export/home/dickl/sol_dense/triboot -D_KERNEL -I/export/home/dickl/sol_dense/include -I/export/home/dickl/sol_dense/release/fepincl -I/export/home/dickl/sol_dense/libdxb -I/export/home/dickl/sol_dense/triboot -c -o /export/home/dickl/sol_dense/dgdxb/sparc/dgtrace.o /export/home/dickl/sol_dense/dgdxb/dgtrace.c -W0,-xphlc_hw.cXa ; O ; V=3.1 ; R=WorkShop Compilers 5.0 dev 28 Mar 1998 C 5.0 dev Build PUT_BUILDNUMBER_HERE/export/home/dickl/sol_dense/triboot; /usr/bintools/cc -O -DSOLARIS -Dsparc -erroff=E_WHITE_SPACE_IN_DIRECTIVE -xCC -DSOLARIS7 -I/export/home/dickl/sol_dense/include -I/export/home/dickl/sol_dense/release/fepincl -I/export/home/dickl/sol_dense/libdxb -I/export/home/dickl/sol_dense/triboot -D_KERNEL -I/export/home/dickl/sol_dense/include -I/export/home/dickl/sol_dense/release/fepincl -I/export/home/dickl/sol_dense/libdxb -I/export/home/dickl/sol_dense/triboot -c hlc_hw.c -W0,-xprap_hw.cXa ; O ; V=3.1 ; R=WorkShop Compilers 5.0 dev 28 Mar 1998 C 5.0 dev Build PUT_BUILDNUMBER_HERE/export/home/dickl/sol_dense/triboot; /usr/bintools/cc -O -DSOLARIS -Dsparc -erroff=E_WHITE_SPACE_IN_DIRECTIVE -xCC -DSOLARIS7 -I/export/home/dickl/sol_dense/include -I/export/home/dickl/sol_dense/release/fepincl -I/export/home/dickl/sol_dense/libdxb -I/export/home/dickl/sol_dense/triboot -D_KERNEL -I/export/home/dickl/sol_dense/include -I/export/home/dickl/sol_dense/release/fepincl -I/export/home/dickl/sol_dense/libdxb -I/export/home/dickl/sol_dense/triboot -c rap_hw.c -W0,-xps2k_hw.cXa ; O ; V=3.1 ; R=WorkShop Compilers 5.0 dev 28 Mar 1998 C 5.0 dev Build PUT_BUILDNUMBER_HERE/export/home/dickl/sol_dense/triboot; /usr/bintools/cc -O -DSOLARIS -Dsparc -erroff=E_WHITE_SPACE_IN_DIRECTIVE -xCC -DSOLARIS7 -I/export/home/dickl/sol_dense/include -I/export/home/dickl/sol_dense/release/fepincl -I/export/home/dickl/sol_dense/libdxb -I/export/home/dickl/sol_dense/triboot -D_KERNEL -I/export/home/dickl/sol_dense/include -I/export/home/dickl/sol_dense/release/fepincl -I/export/home/dickl/sol_dense/libdxb -I/export/home/dickl/sol_dense/triboot -c s2k_hw.c -W0,-xptb_dl.cXa ; O ; V=3.1 ; R=WorkShop Compilers 5.0 dev 28 Mar 1998 C 5.0 dev Build PUT_BUILDNUMBER_HERE/export/home/dickl/sol_dense/triboot; /usr/bintools/cc -O -DSOLARIS -Dsparc -erroff=E_WHITE_SPACE_IN_DIRECTIVE -xCC -DSOLARIS7 -I/export/home/dickl/sol_dense/include -I/export/home/dickl/sol_dense/release/fepincl -I/export/home/dickl/sol_dense/libdxb -I/export/home/dickl/sol_dense/triboot -D_KERNEL -I/export/home/dickl/sol_dense/include -I/export/home/dickl/sol_dense/release/fepincl -I/export/home/dickl/sol_dense/libdxb -I/export/home/dickl/sol_dense/triboot -c tb_dl.c -W0,-xptb_mdone.cXa ; O ; V=3.1 ; R=WorkShop Compilers 5.0 dev 28 Mar 1998 C 5.0 dev Build PUT_BUILDNUMBER_HERE/export/home/dickl/sol_dense/triboot; /usr/bintools/cc -O -DSOLARIS -Dsparc -erroff=E_WHITE_SPACE_IN_DIRECTIVE -xCC -DSOLARIS7 -I/export/home/dickl/sol_dense/include -I/export/home/dickl/sol_dense/release/fepincl -I/export/home/dickl/sol_dense/libdxb -I/export/home/dickl/sol_dense/triboot -D_KERNEL -I/export/home/dickl/sol_dense/include -I/export/home/dickl/sol_dense/release/fepincl -I/export/home/dickl/sol_dense/libdxb -I/export/home/dickl/sol_dense/triboot -c tb_mdone.c -W0,-xptb_reg.cXa ; O ; V=3.1 ; R=WorkShop Compilers 5.0 dev 28 Mar 1998 C 5.0 dev Build PUT_BUILDNUMBER_HERE/export/home/dickl/sol_dense/triboot; /usr/bintools/cc -O -DSOLARIS -Dsparc -erroff=E_WHITE_SPACE_IN_DIRECTIVE -xCC -DSOLARIS7 -I/export/home/dickl/sol_dense/include -I/export/home/dickl/sol_dense/release/fepincl -I/export/home/dickl/sol_dense/libdxb -I/export/home/dickl/sol_dense/triboot -D_KERNEL -I/export/home/dickl/sol_dense/include -I/export/home/dickl/sol_dense/release/fepincl -I/export/home/dickl/sol_dense/libdxb -I/export/home/dickl/sol_dense/triboot -c tb_reg.c -W0,-xptb_wdone.cXa ; O ; V=3.1 ; R=WorkShop Compilers 5.0 dev 28 Mar 1998 C 5.0 dev Build PUT_BUILDNUMBER_HERE/export/home/dickl/sol_dense/triboot; /usr/bintools/cc -O -DSOLARIS -Dsparc -erroff=E_WHITE_SPACE_IN_DIRECTIVE -xCC -DSOLARIS7 -I/export/home/dickl/sol_dense/include -I/export/home/dickl/sol_dense/release/fepincl -I/export/home/dickl/sol_dense/libdxb -I/export/home/dickl/sol_dense/triboot -D_KERNEL -I/export/home/dickl/sol_dense/include -I/export/home/dickl/sol_dense/release/fepincl -I/export/home/dickl/sol_dense/libdxb -I/export/home/dickl/sol_dense/triboot -c tb_wdone.c -W0,-xptribl.cXa ; O ; V=3.1 ; R=WorkShop Compilers 5.0 dev 28 Mar 1998 C 5.0 dev Build PUT_BUILDNUMBER_HERE/export/home/dickl/sol_dense/triboot; /usr/bintools/cc -O -DSOLARIS -Dsparc -erroff=E_WHITE_SPACE_IN_DIRECTIVE -xCC -DSOLARIS7 -I/export/home/dickl/sol_dense/include -I/export/home/dickl/sol_dense/release/fepincl -I/export/home/dickl/sol_dense/libdxb -I/export/home/dickl/sol_dense/triboot -D_KERNEL -I/export/home/dickl/sol_dense/include -I/export/home/dickl/sol_dense/release/fepincl -I/export/home/dickl/sol_dense/libdxb -I/export/home/dickl/sol_dense/triboot -c tribl.c -W0,-xp4  0KU4U8 ]8$#e\*u0/u0 w7j?l K:)TE^x i^ tch070701000d2ae2000041ed0000023d00000064000000053d32bb7100000000000000200000000700000000000000000000000500000003root07070100019c4f000041ed0000023d00000064000000033d32bb6d00000000000000200000000700000000000000000000000900000003root/etc070701000d2ae3000041ed0000023d00000064000000033d32bb6d00000000000000200000000700000000000000000000000e00000003root/etc/digi07070100019c50000041ed0000023d00000064000000033d32bb6d00000000000000200000000700000000000000000000001300000003root/etc/digi/text070701000d2ae4000041ed0000023d00000064000000023d32bb6d00000000000000200000000700000000000000000000001800000003root/etc/digi/text/info070701000d2ae5000081a40000023d000000640000000138c8081100000861000000200000000700000000000000000000002200000003root/etc/digi/text/info/dpa_info1The fields in the DPA main screen have the following meanings: Type: The bus type (EISA, ISA, MC) and board type (C/X, Xem, EPC/X) detected by the Digi device driver. State: The current state of the board. Possible values are: OK Indicates the adapter is functioning normally. NOT FOUND The device driver could not identify this type of board. NO IO The device driver was unable to communicate with the board via the I/O port. Switch settings could be incorrect. NO MEMORY The device driver was unable to allocate the necessary memory for this board. NO BIOS Unable to download the BIOS image. Possible hardware failure. NO FEP/OS Unable to download the FEP/OS image. Possible hardware failure. HD/W FAIL An unrecoverable error with the FEP/OS has been detected. Possible hardware failure. NO PORTS (Xem system only) The BIOS on the Xem host adapter could not detect any ports. Possible hardware failure. I/O Addr: The adapter's I/O port address (hexadecimal). Mem Addr: The starting address of the adapter's dual ported memory (hexadecimal). Mem Size: The size of the adapter's dual ported memory. #Ports: The number of ports for which the device driver has been configured (this may be different than the actual number of ports physically attached). To get more information about one of the displayed adapters, use the up an down arrow keys to move the highlighted bar to the desired board, then press . NOTE: If the arrow keys do not map correctly, the DPA program will display the following message: Invalid Key. If this occurs, substitute the standard UNIX cursor movement keys for the up and down arrows: Down = J or j; Up = K or k; Left = H or h; Right = L or l. 070701000d2ae6000081a40000023d00000064000000012d5a23250000025b000000200000000700000000000000000000002200000003root/etc/digi/text/info/dpa_info2 The current display shows the status of the selected host adapter. Concentrators are represented by: [AC] if active [DN] if inactive (turned off, defective, or otherwise down) The display also shows the speed and wiring method between the host adapter and the first concentrator (node), and between subsequent interconnected concentrators. To see a C/X or EPC/X host adapter's configuration string, use the arrow keys (or H, J, K and L keys, if your arrow keys aren't correctly mapped) to highlight either Adapter Line box, and press . 070701000d2ae7000081a40000023d00000064000000012d5a232500000144000000200000000700000000000000000000002200000003root/etc/digi/text/info/dpa_info3 The configuration string shown is what the FEP/OS has stored in memory during system configuration. The FEP/OS uses this string to determine line speeds and connection types between the host adapter and concentrators, and between interconnected concentrators. This is useful for diagnosing configuration problems. 070701000d2ae8000081a40000023d000000640000000138ecae2000001292000000200000000700000000000000000000002200000003root/etc/digi/text/info/dpa_info4This graphic simulation of the concentrator's front panel is dynamically updated at half second intervals, and shows the current status of the channel selected. Activity on the synchronous channel is indicated by the rotating "helicopters" after the terms "Sync Packets TxD:" and "Sync Packets RxD:" in the upper right-hand corner of the screen. The inner box shows the state of the RS-232 signals TxD, RxD, RTS, CTS, DSR, DCD, DTR, RI, and input and output flow control states (OFC and IFC). An inactive signal is indicated by a dash (-) under its name. An active signal is indicated by a block under its name. If data is currently being transmitted or received, a blinking "X" will appear under the signal name (TxD or RxD, respectively). The status of the concentrator appears at the far right of the inner box; DN if the communication to the host adapter is down. (AC, 16em, 8em, 8emp, M4em, or M8em) if the connection to the host adapter is good. Input Modes *Not a standard UNIX flag IGNBRK Ignore Break BRKINT Interrupt on Break IGNPAR Ignore parity errors PARMRK Mark parity errors INPCK Input parity check ISTRIP Strip input characters ITOSS* Toss IXANY characters IXON Enable start/stop output IXANY Restart output on any character IXOFF Enable start/stop input IXONA* Enable start/stop output Auxiliary Output Modes *Not a standard UNIX flag XCASE* Canonical upper/lower display OLCUC Map lower case to upper ONLCR Map NL to CR/NL OCRNL Map CR to NL ONOCR No CR output at column 0 ONLRET NL performs CR function OFILL Use fill characters for delay OFDEL Fill character is DEL; otherwise NUL NLDLY NL delay is selected CR1 Carriage Return delay type 1 CR2 Carriage Return delay type 2 CR3 Carriage Return delay type 3 TAB1 Tab delay type 1 TAB2 Tab delay type 2 TAB3 Tab delay type 3 BS1 Backspace delay VT1 Vertical tab delay FF1 Form feed delay Control Modes Baud Rate 50, 75, 110, 134, 150, 200, 300, 600, 1200, 1800, 2400, 4800, 9600, 19200, 38400. If Fast Baud is set baud rates of 50, 75, 110, 200, 2400 and 4800 are translated to 57600, 75600, 115200, 230400, 460800 and 921600 respectively. For parallel ports, the baud rate defines the pulse width of the data strobe. Char Bits 5,6,7,8, or None. Stop Bits 2,1, or None. Parity Enabled, Odd, or None. Fast Baud* Use fast baud rates. *Not a standard UNIX flag LoopBack Test: If the channel is not on a Modem 4em or Modem 8em, a loopback plug must be installed in the channel to be tested. A loopback diagnostic test can be run against any selected channel by pressing the T (or t) key from the channel monitoring screen. If the channel is on a Modem 4em or Modem 8em, an additional channel is required to do the loopback test and a loopback plug is not used. Select the first loopback channel by pressing the T (or t) key from the channel monitoring screen. The next screen presented will list the legal choices for the second loopback channel and allow a choice to be made. The two selected channels must be connected to each other using a standard RJ11 phone cable. The loopback plug specification: The loopback plug for RJ-45 versions (Digi Int'l Part Number 60000401) consists of a single 10-pin RJ-45 plug wired as follows: Pin 3 connected to pin 1 and 8 (RTS to RI and CTS); Pin 5 connected to pin 6 (TxD to RxD); Pin 9 connected to pin 2 and 10 (DTR to DSR and DCD). For DB-25 versions (Digi Int'l Part Number 60000442), the loopback plug consists of a female DB-25 connector wired as follows: Pin 4 connected to pin 22 and 5 (RTS to RI and CTS); Pin 2 connected to pin 3 (TxD to RxD); Pin 20 connected to pin 6 and 8 (DTR to DSR and DCD). Note: The port(s) must be disabled prior to running the loopback test. The Print Screen (^P) option invokes a screen dump to the default file /tmp/dpalog. If another file and/or path is desired, simply invoke dpa with the -l option. e.g. dpa -l 070701000d2ae9000081a40000023d000000640000000138ecae2100000a61000000200000000700000000000000000000002200000003root/etc/digi/text/info/dpa_info5This graphic simulation of the concentrator's front panel for the parallel port, (Channel 9) of a PORTS/8emp module, is dynamically updated at half second intervals, and shows the current status of the channel selected. IP1, IP2, and IP3 reflect the state of Input Ports 1-3 (usually ERROR, SELECT, and FAULT, respectively). OP reflects the state of Output Port 2 (usually SELECTIN). OFC or IFC reflect BUSY status (depending on output or input mode, respectively). An inactive signal is indicated by a dash (-) under its name. An active signal is indicated by a block under its name. If data is currently being transmitted or received, a blinking "X" will appear under the signal name (TxD or RxD, respectively). Input Modes *Not a standard UNIX flag IGNBRK Ignore Break BRKINT Interrupt on Break IGNPAR Ignore parity errors PARMRK Mark parity errors INPCK Input parity check ISTRIP Strip input characters ITOSS* Toss IXANY characters IXON Enable start/stop output IXANY Restart output on any character IXOFF Enable start/stop input IXONA* Enable start/stop output Auxiliary Output Modes *Not a standard UNIX flag XCASE* Canonical upper/lower display OLCUC Map lower case to upper ONLCR Map NL to CR/NL OCRNL Map CR to NL ONOCR No CR output at column 0 ONLRET NL performs CR function OFILL Use fill characters for delay OFDEL Fill character is DEL; otherwise NUL NLDLY NL delay is selected CR1 Carriage Return delay type 1 CR2 Carriage Return delay type 2 CR3 Carriage Return delay type 3 TAB1 Tab delay type 1 TAB2 Tab delay type 2 TAB3 Tab delay type 3 BS1 Backspace delay VT1 Vertical tab delay FF1 Form feed delay Control Modes Baud Rate 50, 75, 110, 134, 150, 200, 300, 600, 1200, 1800, 2400, 4800, 9600, 19200, 38400. If Fast Baud is set baud rates of 50, 75, 110, 200, 2400 and 4800 are translated to 57600, 75600, 115200, 230400, 460800 and 921600 respectively. For parallel ports, the baud rate defines the pulse width of the data strobe. Char Bits 5,6,7,8, or None. Stop Bits 2,1, or None. Parity Enabled, Odd, or None. Fast Baud* Use fast baud rates. *Not a standard UNIX flag LoopBack Test: A loop back plug must be installed in the channel to be tested. (Digi part number 60000401 for RJ-45, or 60000442 for DB-25). 070701000d2aea000081a40000023d00000064000000013255587b00000252000000200000000700000000000000000000002200000003root/etc/digi/text/info/dpa_info6The current display shows the status of the selected Xem host adapter. Attached PORTS and Modem modules are each identified by one of the following: [16em] for PORTS/16em modules [8em] for PORTS/8em modules [8emp] for PORTS/8emp modules [M4em] for Modem 4em modules [M8em] for Modem 8em modules The Print Screen (^P) option invokes a screen dump to the default file /tmp/dpalog. If another file and/or path is desired, simply invoke dpa with the -l option. e.g. dpa -l 070701000d2aeb000081a40000023d000000640000000138c8081700001bd0000000200000000700000000000000000000002200000003root/etc/digi/text/info/dpa_info7 Host Status (C/X and EPC/X Systems Only) The DPA program provides several status and error counters to aid you in monitoring activity between the host adapter and concentrators, and diagnosing possible communication problems. Several of the counters increment steadily under normal conditions. An incrementing counter does not necessarily indicate a problem. For example, if a concentrator is turned off, several counters will increment. When the concentrator is turned back on, those counters will stop incrementing. If any counters that are usually idle begin to increment steadily, perform the recommended tests described for that counter. Call Digi Technical Support if the counters continue to increment steadily after performing the recommended tests. Activity Counters RECEIVE1 The number of times the host adapter processed a request from a concentrator, and one packet was received. Under idle conditions, RECEIVE1 will increment, representing the "heartbeat" of the concentrators communicating with the host. RECEIVE2 through RECEIVE4 The number of times the host adapter processed a request from a concentrator, and two, three, or four packets were received. RECEIVE5 The host adapter is 100% busy if RECEIVE5 is incrementing. Users may experience slower response time. Monitor EC (Error Count) on the concentrator front panel. The Digi product in use is being maximized. Consider adding another host adapter, or advance to the EPC/X system if you are currently using the standard C/X product. TRANSMIT The number of data packets transmitted from the host. Under idle conditions, the TRANSMIT counter will increment. This is the "heartbeat" of the host checking the status of communications to the concentrators. Under normal operating conditions,m the TRANSMIT counter will increment. Sync Counters *For diagnostic information see the concentrator Installation Guide. ERR_UFRAM The host adapter received an incomplete packet. Check the physical hardware configuration to ensure a stable environment. Check for other incrementing counters. ERR_ABSTAT The host adapter received a bad data packet, and discarded it. Check for concentrator "down" [DN] status. Check the physical hardware configuration. If the ERR_ABSTAT counter is constantly incrementing, run the concentrator diagnostics*. Call Digi Technical Support. ERR_INC The host adapter received an incomplete data packet. Check the physical hardware configuration. If this counter is constantly incrementing, call Digi Technical Support. ERR_CRC The host adapter received a packet with a CRC error. Run the concentrator sync line diagnostic tests*. If this counter is constantly incrementing, call Digi Technical Support. ERR_DATA The host adapter received a packet with an error found in the data. This will cause other counters to increment. Check sync line connections. Run the concentrator sync line diagnostic tests*. If this counter is constantly incrementing, call Digi Technical Support. ERR_NACK The host adapter received a negative acknowledgement from the concentrator for one of its messages. Check sync line connections. Run C/X host adapter diagnostics*. If this counter is constantly incrementing, call Digi Technical Support. *For diagnostic information see the concentrator Installation Guide. Saturation Counters ERR_TBUF The transmit buffers on the host adapter are full. The data is not getting out to the ports fast enough. Also monitor RECEIVE1 through RECEIVE5 and TRANSMIT counters. ERR_FIFO The host adapter is receiving more data than it can handle. Also monitor RECEIVE5. ERR_ORUN The host adapter is receiving too much data; the host is 100% busy. The Digi product in use is being maximized. Consider adding another host adapter, or advance to the EPC/X system if you are currently using the standard C/X product. ERR_TBUSY The number of times the host adapter tried to transmit data when the transmitter was busy. Also monitor RECEIVE counters. ERR_RITEM The receive buffer on the host adapter is full; the host adapter is 100% busy. Also monitor the ERR_ORUN counter. FEP Counters ERR_REC0 The number of times the host adapter received a request from a concentrator, but no packets were received. If the environment is stable and no other counters are incrementing call Digi Technical Support. ERR_ADDR The host adapter received a message that contains an invalid node number. This is not a physical node number error, but a software node number error. If this counter is constantly incrementing, call Digi Technical Support. ERR_MTYPE The host adapter received a message with a bad message type. If this counter is constantly incrementing, call Digi Technical Support. ERR_MSIZE The host adapter received a message with a bad length. If this counter is constantly incrementing, call Digi Technical Support. ERR_RID The host adapter received a message with an out-of-sequence message ID. This is not a physical node number error, but a software node number error. If this counter is constantly incrementing, call Digi Technical Support. ERR_TID The host adapter sync line transmit sequence number is out of sequence. If this counter is constantly incrementing, call Digi Technical Support. ERR_PING The host adapter received a sync line ping message when not in ping mode. If this counter is constantly incrementing, call Digi Technical Support. Hardware Counters ERR_ABREC The host adapter aborted receiving a packet. Run C/X host adapter diagnostics. If a hardware problem is detected, try a different host adapter. ERR_URUN The host adapter transmitted an incomplete packet. Run C/X host adapter diagnostics. If a hardware problem is detected, try a different host adapter. ERR_CONC A message sent to the concentrators was sent back to the host adapter. A concentrator is down. Back up one screen in DPA to check for "DN" status on a concentrator. Check the power on the concentrator and reset the concentrator. If the counter is still incrementing, try a different concentrator. ERR_CHECK The host adapter received an incomplete status packet. Run concentrator diagnostics. If a hardware problem is detected, try a different concentrator. 070701000d2aec000081a40000023d00000064000000013255575100000269000000200000000700000000000000000000002200000003root/etc/digi/text/info/dpa_info8Select the second channel to be used for Modem 4em or Modem 8em loopback testing. The first of the two channels was selected by pressing the T (or t) key from the channel monitoring screen. Press the ESC key to cancel loopback second channel selection or to select a different first channel. Select the second loopback channel by pressing a number from the list of valid channel numbers shown on the screen. The Print Screen (^P) option invokes a screen dump to the default file /tmp/dpalog. If another file and/or path is desired, simply invoke dpa with the -l option. e.g. dpa -l 070701000d2aed000081a40000023d000000640000000132c939b700000e29000000200000000700000000000000000000002200000003root/etc/digi/text/info/dpa_info9 ****************************************** * Important Note * * * * Care must be taken during em/Modem * * Flash ROM Load. Please take time to * * read this entire help file to insure * * that Flash ROM Load problems are * * avoided. * * * ****************************************** FLASH ROM LOAD RISKS The Modem chipset used in the em/Modem Module uses modem AT commands to load the Flash ROM. If Modem Flash ROM Load is interrupted and is unable to complete, the Flash ROM in the modem that was being loaded will no longer be functional. Without a functional Flash ROM, it will not be able to handle the AT commands to load the Flash ROM and either the affected chipset or the entire em/Modem module will have to be shipped to Digi to have the Flash ROM restored. When planning em/Modem Flash ROM Load, choose a time when the system is relatively quiet and stable to minimize the possibility that the system could go down during the load. NOTE: When Flash ROM load completes, the modem will be set to use Factory Default Option settings. FLASH ROM LOAD CHOICES This utility allows em/Modems to have their Flash ROM Loads in in groups or individually. Choices are: o Load all of the em/Modems on this system o Load all of the em/Modems on this adapter o Load all of the em/Modems on the module/concentrator o Load a specific em/Modem FLASH ROM LOAD PROCEDURE Insure that both the Flash ROM file to be loaded and the Flash ROM loader are located in the directory '/etc/digi/em_modem'. If the 'em_modem' subdirectory doesn't exist, you will have to create it. There can be more than one Flash ROM file in this directory but only one Flash ROM loader. The Flash ROM loader must be named "flashrom.loader". Flash ROM files must end with ".flrom", i.e., "rom.1.2.flrom", "flrom.flrom", etc. The latest Flash ROM file and Flash ROM loader can be downloaded from the Digi Bulletin Board, ftp site, or home page. Refer to your Digi hardware/software manual for information on how to access these sites. NOTE that the "/etc/digi/em_modem" directory is removed and its contents lost whenever the mpi package is removed. This utility will present a list of all Flash ROM files found in the directory, allowing the user to choose one for the load process. Once the Flash ROM file and em/Modems to be loaded have been chosen, the load will proceed. If more than one em/Modem is to be loaded, this utility will pause briefly between loads to allow the user halt further loads. Once a load has begun, the user will NOT be given the option of halting until it completes. Loading of multiple em/Modems will proceed without user intervention unless this utility finds a modem with the the same or newer Flash ROM already loaded in the modem. Then the user will be promted to decide whether to skip to the next modem or load anyway. WHY A FLASH ROM LOAD MIGHT FAIL The Flash ROM loader will not load a modem if: o The Flash ROM loader was not able to open to the modem port for exclusive use. o The modem doesn't respond to AT commands o The modem chipset doesn't match the selected Flash ROM file FLASH ROM LOAD REPORT Once all specified em/Modems have been loaded, this utility will display an em/Modem load report showing which modems were loaded and which were not loaded. 070701000d73a9000041ed0000023d00000064000000033d32bb6d00000000000000200000000700000000000000000000000900000003root/opt07070100019c51000041ed0000023d00000064000000053d32bb7100000000000000200000000700000000000000000000001100000003root/opt/DIGIras070701000d2aee000041ed0000023d00000064000000023d32bb6d00000000000000200000000700000000000000000000001500000003root/opt/DIGIras/bin070701000d2aef000081a40000023d00000064000000013d2f251700001eb4000000200000000700000000000000000000002d00000003root/opt/DIGIras/bin/dgdxb_board_to_instanceELF4|4 (44     /usr/lib/ld.so.18,4)&#-3%07.*256"$' (+1/!L ,D     @  D  H     , P x  D  h  ( > E J PR 8 X t` i 8p hv ,|  h!  p t \     D  @ P  8 _startatoi_environ_end_ex_register_GLOBAL_OFFSET_TABLE_atexitexitsprintf_init___Argv_DYNAMICprintfioctl_exit_ex_deregisterenvironerrno__cg92_usedcloseopen_edata_PROCEDURE_LINKAGE_TABLE___fsr_init_value_etext_lib_versionmain__environ_lock_finilibc.so.1SISCD_2.3libc.so.1zt 0* , ! " ,) 8' D P# \/ h( t. @D"at, @'$h+`-` `?-)!l- =--% # @@B@@#@`@ @@@@`'H'DD  B#HH@@ ?@'H@@ 'Bchx@@@ @@@' B#p!!@@@"'!!'' ''c@@~  B#!@@i!@@v'B#@@a'㿠@`?㿠@(?error: usage: %s board_number %s%dFailed to open %s: errno=%i Failed to send DGDXB_INFO_BOARD_TO_INSTANCE ioctl: errno=%i instance=%i  00<0H0T0`0l0x000$   o o =L o lD, | /dev/DIGIras/mgmtL ,D     @  D  H     , P x 6 BI 4U @ `jq l D @   D h       P( 8 . t< E 8L hR ,X g h!o u p t \     D  @ P 8 /export/home/dickl/sol_dense/install/gui/dgdxb_board_to_instancecrti.s_ex_shared0_ex_range0_ex_text0crt1.s__crt_scratchvalues-Xa.cdgdxb_board_to_instance.ccrtn.s_ex_shared1_ex_range1_ex_text1_start_START_atoi_environ_end_ex_register_GLOBAL_OFFSET_TABLE_atexitexitsprintf_init___Argv_END__DYNAMICprintfioctl_exit_ex_deregisterenvironerrno__cg92_usedcloseopen_edata_PROCEDURE_LINKAGE_TABLE___fsr_init_value_etext_lib_versionmain__environ_lock_fini <v4*@(#)stdlib.h 1.44 98/01/22 SMI@(#)feature_tests.h 1.17 97/12/04 SMI@(#)isa_defs.h 1.15 97/11/22 SMI@(#)stdio.h 1.69 98/07/13 SMI@(#)va_list.h 1.11 97/11/22 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.7 98/04/17 SMI@(#)stropts.h 1.9 96/04/26 SMI@(#)stropts.h 1.44 98/04/28 SMI@(#)types.h 1.63 98/04/28 SMI@(#)machtypes.h 1.12 96/08/01 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.62 98/02/04 SMI@(#)time.h 1.36 98/03/27 SMI@(#)time_impl.h 1.3 98/02/13 SMI@(#)conf.h 1.57 98/01/06 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.19 98/04/14 SMI@(#)param.h 1.63 98/06/03 SMI@(#)unistd.h 1.36 98/07/16 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.10 98/02/18 SMI@(#)unistd.h 1.55 98/04/14 SMI@(#)errno.h 1.15 98/03/02 SMI@(#)errno.h 1.19 98/01/14 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.44 98/06/04 SMIacomp: WorkShop Compilers 5.0 dev 28 Mar 1998 C 5.0 dev Build PUT_BUILDNUMBER_HEREld: Software Generation Utilities - Solaris/ELF (3.0).interp.hash.dynsym.dynstr.SUNW_version.rela.ex_shared.rela.plt.text.init.fini.exception_ranges.rodata.rodata1.got.plt.dynamic.ex_shared.data.data1.bss.symtab.strtab.stab.index.comment.shstrtab.stab.indexstrdgdxb_board_to_instance.cXa ; V=3.1 ; R=WorkShop Compilers 5.0 dev 28 Mar 1998 C 5.0 dev Build PUT_BUILDNUMBER_HERE/export/home/dickl/sol_dense; /usr/bintools/cc -I/export/home/dickl/sol_dense/include -c /export/home/dickl/sol_dense/install/gui/dgdxb_board_to_instance.c -W0,-xpmain d LL=o  -,, =DDl G M 8S  8Y @ @k D Ds H H|     , ,  P P( x x  ,0 89q[ 070701000d2af0000081a40000023d00000064000000013d2f24e400002dfc000000200000000700000000000000000000002200000003root/opt/DIGIras/bin/digiras_infoELF 4)4 (4488/usr/lib/ld.so.15;2+#)8*79&:65,$.'04-(1!%"3 /` @ ` x   H L P 8(< @ #9@EM8 SZ$b8k t h !< (;  " :L GL[8 _start_environ_end_ex_register_GLOBAL_OFFSET_TABLE_atexitexitsprintf_initgetuid___Argv_DYNAMICsprint_digi_adapter_descriptionprintfioctl_exitget_integer_print_size_ex_deregisterenvironerrno__cg92_usedcloseopen_edata_PROCEDURE_LINKAGE_TABLE___fsr_init_value_etextsprint_centered_integer_lib_versionmain__environ_lock_finilibc.so.1SISCD_2.3libc.so.1aztk, !*"$(1)(0 @D"c$, @'$+`-` `?-)#- =--% # @BD@BӐ#@@@B@B -? ? < ? ?` ?/ ?ڄ$/     d #   a Є@ &% & 㿐`9DP@Bi&@2 8"D@BZT`  /@ &/@   J/@  &J$ /@  /@  `@&/@ /@ l| 4DTdt㿠`5  #o $YE`5- @"ERPQDhRS"DDDX@A(D\@A<`@APDd@Adh@AxVTUDVW"DDD@Aϕ裌D@Aʕ裨@AƕD@A@A01 D D@AD@A(@A<&` 8ȇ* CaD@AD@AD@AD@AD@AD@AD@A D@A~`D@Az`(D@Av`<D@Ar`PD@An`dD@Aj`x&B (P* Ca@E@A\ E@AX`E@AT`(E@AP`<E @AL`PE$@AH`dE(@AD`E,@A@`E0@A<`@A:H@A6E\@A3`?E|@A0  E@A(<E@A#?' '''@A? E@A<E@A ?E@AE@AE3@@(, 'a@@E@@\  q  lE|0@@O@E@@Ԙ@&'@@ؐ 㿠@ ?㿠@?%d%d%s%s%s%s%s - unknown subtype%s%s%s%s%s - unknown subtype%s%s%s - unknown subtype%s%s%s%s%s%s%s%s%s%s%s%s%s - unknown subtype%s%s%s%s%s%s%s%s%s - unknown subtypeunknown board typeMust be super-user to run %s. /dev/DIGIras/dgdxb_mgmt0Failed to open info device errno: %i Failed to send DIGI_GETDD ioctl errno: %i board# instance device name description ------ -------- --------------- --------------- ioctl failed for this adapter %s%c01m%s %s %s %s 800<0H0T0`0l0x000u  o @o`  ol x ` ``DataFire RAS 24 PT1DataFire RAS 30 PE1DataFire RAS 48 PT2DataFire RAS 60 PE2DataFire RAS PTEDataFire DSP 24 PT1 cPCIDataFire DSP 30 PE1 cPCIDataFire DSP 48 PT2 cPCIDataFire DSP 60 PE2 cPCIDataFire DSP PTE cPCIDataFire RAS B4UDataFire RAS B4STDataFire RAS B4STUAccelePort RAS 4AccelePort RAS 4AccelePort RAS 4AccelePort RAS 4AccelePort RAS 4AccelePort RAS 4AccelePort RAS 8AccelePort RAS 8AccelePort RAS 8AccelePort RAS 8AccelePort RAS 8AccelePort RAS 8AccelePort RASAccelePort 2p PCIAccelePort 4p PCIAccelePort 8p PCIAccelePort 16p PCIAcceleport 32p PCIAcceleport 4p PCI EIA-232/422/485Acceleport 8p PCI EIA-232/422/485Acceleport 16p PCI EIA-232/422/485AccelePort Xp/dev/dgras` @ ` x   H L P 8(<!@6=IH T ^esH  @  8 $'80 tPW]c hz !< (;  L   8 /export/home/dickl/sol_dense/util/sparc/digiras_infocrti.s_ex_shared0_ex_range0_ex_text0crt1.s__crt_scratchvalues-Xa.cdigiras_info.ccrtn.s_ex_shared1_ex_range1_ex_text1_start_START__environ_end_ex_register_GLOBAL_OFFSET_TABLE_atexitexitsprintf_initgetuid___Argv_END__DYNAMICsprint_digi_adapter_descriptionprintfioctl_exitget_integer_print_size_ex_deregisterenvironerrno__cg92_usedcloseopen_edata_PROCEDURE_LINKAGE_TABLE___fsr_init_value_etextsprint_centered_integer_lib_versionmain__environ_lock_fini<o4*cg: WorkShop Compilers 5.0 dev 28 Mar 1998 Build PUT_BUILDNUMBER_HERE@(#)stdio.h 1.69 98/07/13 SMI@(#)feature_tests.h 1.17 97/12/04 SMI@(#)isa_defs.h 1.15 97/11/22 SMI@(#)va_list.h 1.11 97/11/22 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.7 98/04/17 SMI@(#)unistd.h 1.55 98/04/14 SMI@(#)types.h 1.63 98/04/28 SMI@(#)machtypes.h 1.12 96/08/01 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.62 98/02/04 SMI@(#)time.h 1.36 98/03/27 SMI@(#)time_impl.h 1.3 98/02/13 SMI@(#)unistd.h 1.36 98/07/16 SMI@(#)ioctl.h 1.9 92/07/14 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.44 98/06/04 SMI@(#)errno.h 1.15 98/03/02 SMI@(#)errno.h 1.19 98/01/14 SMI@(#)stream.h 1.79 98/06/11 SMI@(#)vnode.h 1.80 98/08/03 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.19 98/04/14 SMI@(#)param.h 1.63 98/06/03 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.10 98/02/18 SMI@(#)cred.h 1.21 97/01/09 SMI@(#)uio.h 1.29 97/06/29 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)seg_enum.h 1.3 95/12/22 SMI@(#)poll.h 1.26 98/06/12 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.20 97/09/22 SMI@(#)stropts.h 1.44 98/04/28 SMI@(#)conf.h 1.57 98/01/06 SMI@(#)digi.h 1.33 96/06/07acomp: WorkShop Compilers 5.0 dev 28 Mar 1998 C 5.0 dev Build PUT_BUILDNUMBER_HEREld: Software Generation Utilities - Solaris/ELF (3.0).interp.hash.dynsym.dynstr.SUNW_version.rela.ex_shared.rela.plt.text.init.fini.exception_ranges.rodata.rodata1.got.plt.dynamic.ex_shared.data.data1.bss.symtab.strtab.stab.index.comment.shstrtab.stab.indexstrdigiras_info.cXa ; O ; V=3.1 ; R=WorkShop Compilers 5.0 dev 28 Mar 1998 C 5.0 dev Build PUT_BUILDNUMBER_HERE/export/home/dickl/sol_dense; /usr/bintools/cc -O -DSOLARIS -Dsparc -erroff=E_WHITE_SPACE_IN_DIRECTIVE -xCC -DSOLARIS7 -I/export/home/dickl/sol_dense/include -I/export/home/dickl/sol_dense/release/fepincl -I/export/home/dickl/sol_dense/libdxb -I/export/home/dickl/sol_dense/triboot -I/export/home/dickl/sol_dense/dgdxb -U_KERNEL -c /export/home/dickl/sol_dense/util/digiras_info.c -W0,-xpmain  ``o @ @ - ` ` = x xl G M8S8YHHkLLsPPD| 88 (((<<<,&!$0 !T&'070701000d2af1000081a40000023d00000064000000013d2f24e5000030a8000000200000000700000000000000000000002300000003root/opt/DIGIras/bin/digiras_resetELF 4,H4 (44h/usr/lib/ld.so.15FE;+(1B2AC-D@3*507>=#$ 8?/"9&,'.)4<%:6!<          <`l  xx$@!) 6LHRY^ f8 l  T   `  @0 x!<  #*D$K\`cj wp  |`8 getopt_startstrtol_environ_end_iob_ex_register_GLOBAL_OFFSET_TABLE_sleepatexitexitsprintf_initreset_serial_channelgetuidhangup_or_reset_modem___Argv_DYNAMICusageprintf__iobioctl_exit_ex_deregisterenvironerrno__cg92_usedclosereset_all_serial_channelsopenoptarg_edata_PROCEDURE_LINKAGE_TABLE_memset__fsr_init_valuestrcpy_etext_lib_versionmain__environ_lock_finifprintflibc.so.1SISCD_2.3libc.so.1zt@3<"0 :%&2E '9$=01<7H$T*`?lx/ @D"c, @'$x+`-` `?-)#|- =--% # @CpD@Cm#@@ @Cf@CgcE`@Cb㾀E@C]@C] ? E@CM? @CO  ' ' '' ''''@C8? E@C#,@C0?@C, pEt@C@C ? E|@C? @C ' ''Ԅ ''''܄''''@B? E@B@B?@B hE@B֖@B֒ ? E@BƔ? 9@BƔ ''؄ 'ܔؒ#'@B'䀢? F@B @B?   Ƞ (   Ȓ @B '̔'В#'ؐ''''@B'䀢?   @B @B  F`@Bi?       @Bp @Bn`F@Bl* : ?]F c R :O ?M A< I R1 b B r c h 9 r x 2 @B@"  @B:"  @B5  @B/ @B*   @B$ @B@B* : ? c  ``Ζ`F@B?z F@A?  i  @AԐ ^  F@Aא@? ֐F@Aʐx? F@AÐ@A H㿠@?㿠@x? Usage: %s [-b adapter] [-c channel] [-h hangup_cmd] [-r reset_modem_cmd] [-x reset_channel_cmd] [-R reset_channel_cmd] [-A reset_all_cmd] -b -- Zero-based Adapter (board) number (default 0) -c -- One-based Channel number (default 1) -h -- Hangup modem (0=Nothing, 1=Hangup) -r -- Reset modem (0=Nothing, 1=Power cycle, 2=ATZ, 3=AT&F) -x -- Reset channel (0=Nothing, 0x1=Unpause rx, 0x2=Unpause tx, 0x4=Reset) -R -- Reset channel completely (0=Nothing, 1=Reset) (like -x, but done with all options on and done several times with 1 second delays between each reset) -A -- Reset all channels (0=Nothing, 1=Reset) (Caution! Does a complete reset of all channels on an adapter) %s%dError: Failed to open %s (errno = 0x%x). Error: Failed to send getset_serial_ext_config ioctl (errno = 0x%x). %s%dError: Failed to open %s (errno = 0x%x). Error: Failed to send getset_modem_config ioctl (errno = 0x%x). %s%dError: Failed to open %s (errno = 0x%x). Error: Failed to send get_digiras_info ioctl (errno = 0x%x). Error: Failed to send resets on %u channels Only the super-user may execute this program! b:c:h:r:x:R:A:?b:c:h:r:x:R:A:? Command has been executed with error. Command has been executed with error (errno = 0x%x) Command has been executed with error (errno = 0x%x) Error: Failed to reset all of the channels 00<0H0T0`0l0x000000000  o o< O o   LL/dev/DIGIras/mgmt/dev/DIGIras/mgmt/dev/DIGIras/mgmt<          <`g7>DJ U _f|tT  l  xx@!  H '8 -  BTI  _mv `  |@0 x!<   $#`*1 >p  C`R8 X/export/home/dickl/sol_dense/util/sparc/digiras_resetcrti.s_ex_shared0_ex_range0_ex_text0crt1.s__crt_scratchvalues-Xa.cdigiras_reset.ccrtn.s_ex_shared1_ex_range1_ex_text1getopt_start_START_strtol_environ_end_iob_ex_register_GLOBAL_OFFSET_TABLE_sleepatexitexitsprintf_initreset_serial_channelgetuidhangup_or_reset_modem___Argv_END__DYNAMICusageprintf__iobioctl_exit_ex_deregisterenvironerrno__cg92_usedclosereset_all_serial_channelsopenoptarg_edata_PROCEDURE_LINKAGE_TABLE_memset__fsr_init_valuestrcpy_etext_lib_versionmain__environ_lock_finifprintf<p4*cg: WorkShop Compilers 5.0 dev 28 Mar 1998 Build PUT_BUILDNUMBER_HERE@(#)stdio.h 1.69 98/07/13 SMI@(#)feature_tests.h 1.17 97/12/04 SMI@(#)isa_defs.h 1.15 97/11/22 SMI@(#)va_list.h 1.11 97/11/22 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.7 98/04/17 SMI@(#)unistd.h 1.55 98/04/14 SMI@(#)types.h 1.63 98/04/28 SMI@(#)machtypes.h 1.12 96/08/01 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.62 98/02/04 SMI@(#)time.h 1.36 98/03/27 SMI@(#)time_impl.h 1.3 98/02/13 SMI@(#)unistd.h 1.36 98/07/16 SMI@(#)stdlib.h 1.44 98/01/22 SMI@(#)errno.h 1.15 98/03/02 SMI@(#)errno.h 1.19 98/01/14 SMI@(#)string.h 1.22 97/12/22 SMI@(#)conf.h 1.57 98/01/06 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.19 98/04/14 SMI@(#)param.h 1.63 98/06/03 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.10 98/02/18 SMI@(#)stream.h 1.79 98/06/11 SMI@(#)vnode.h 1.80 98/08/03 SMI@(#)cred.h 1.21 97/01/09 SMI@(#)uio.h 1.29 97/06/29 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)seg_enum.h 1.3 95/12/22 SMI@(#)poll.h 1.26 98/06/12 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.20 97/09/22 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.44 98/06/04 SMI@(#)stropts.h 1.44 98/04/28 SMIacomp: WorkShop Compilers 5.0 dev 28 Mar 1998 C 5.0 dev Build PUT_BUILDNUMBER_HEREld: Software Generation Utilities - Solaris/ELF (3.0).interp.hash.dynsym.dynstr.SUNW_version.rela.ex_shared.rela.bss.rela.plt.text.init.fini.exception_ranges.rodata.rodata1.got.plt.dynamic.ex_shared.data.data1.bss.symtab.strtab.stab.index.comment.shstrtab.stab.indexstrdigiras_reset.cXa ; O ; V=3.1 ; R=WorkShop Compilers 5.0 dev 28 Mar 1998 C 5.0 dev Build PUT_BUILDNUMBER_HERE/export/home/dickl/sol_dense; /usr/bintools/cc -O -DSOLARIS -Dsparc -erroff=E_WHITE_SPACE_IN_DIRECTIVE -xCC -DSOLARIS7 -I/export/home/dickl/sol_dense/include -I/export/home/dickl/sol_dense/release/fepincl -I/export/home/dickl/sol_dense/libdxb -I/export/home/dickl/sol_dense/triboot -I/export/home/dickl/sol_dense/dgdxb -U_KERNEL -c /export/home/dickl/sol_dense/util/digiras_reset.c -W0,-xpmain  `<<Oo -  =  G  Q W8]8cu} << ``(:Hp-!4`#0 #)U*I070701000d2af2000081a40000023d00000064000000013d2f24da00003564000000200000000700000000000000000000002d00000003root/opt/DIGIras/bin/digiras_update_devlinksELF 414 (44oopp/usr/lib/ld.so.15I<'-C;F4ABG2H:@5D7>(6#+1 E?3,)"!$.0*8=&/%9x t       ( , 0pt(Hp"t   #d(`1$6 CKpa n" v}8  LpX8 T  l( $`!,$ 2@9hE aj!qto, " ! p( 4H8 convert_to_oldstyle_device_startatoi_environ_end_ex_registerreaddir_GLOBAL_OFFSET_TABLE_find_pattern__ctypeatexitexitdigiras_create_device_linksaccesssprintfsymlinkopendir_initdigiras_create_oldstyle_device_linksgetuid___Argvstrncpy_DYNAMICprintf_exit_ex_deregisterenvironerrnounlink__cg92_useddigiras_remove_device_linksclosedir_edata_PROCEDURE_LINKAGE_TABLE___fsr_init_valuestrcpy_etext_lib_version_ctypemainreadlinkstrlenstrstr__environ_lock_finilibc.so.1SISCD_2.3libc.so.1zt,5(!"%&'4/3F,E;?"(14D@8L)X+dp* @D"bl, @'$`+`-` `?-)"d- =--% # @CF@Cߐ!@"@ @C@C㿠@CF0@C`?       J#\ F@\ @CF9 h@C@F1 t@C@F) |@C@F! @C@ #\F@C@F @C@F @C@2  `&@?x?@??@??@??@?ؒ?@?@ `    @   0@  < L@  `  T d l |@ؘ      @Ϙ    Д ؖ @Ƙ   ! !!(!4@!@\ !@R \  ` !\!l!x!@!`!D!P@A `` !!!!@!!Ԁ !ؒ!!"@" $""$"4"@@"L "P"`"p"@~" """"@u"Ȁ "̒"ܔ""@l# 㷠@BА  F@B’?@BƐ F@B@B?@B /.@B.3   @i ?!@B@B#? *@B@B   @B@B֤ @B{ @Bl  F4@B^?@Bb@B_g#\ b#`F@BT /- *@BE\@BE` *  *@B>: @B)/ @ ?'@ ?@B@@B@B\@B"  @B@B@B@Bʪ @A?F@A@A?㶘@A  F@Aג?@Aڐ@A֐`j #\f#`@AВ /` .@*@A\@A` *  *@AA G\@A5 @i -@a %@2@A#`@A`@A\@A  @A|@A|@A@Azâ @Ao?G@A^@Ah?㿘N  @"`aJ @?J"`'/J/@Ag/ ,?c4 ? c8 ?Gd@A\ 㿠  N@   `*  ` `#"  `* `\"  "J .      N@  O7``# `*O   O   O " `Oဢ`?  N@ @6 ?O.  `N@ ?㿠@t?㿠@<?%s: error: must be super user to execute oldstyleremove_allno_devno_cuano_termno_cuno_lpno_ttydigiras_remove_device_links: error: open of the %s directory failed: errno: %i digiras_remove_device_links: error: not enough buffer space digiras_create_device_links: error: open of the %s directory failed: errno: %i digiras_create_device_links: error: not enough buffer space dgasydigiras_create_device_links: error: open of the %s directory failed: errno: %i digiras_create_device_links: error: not enough buffer space dgasyb%02dp%02d00<0H0T0`0l0x000000000000  o tox  ot   `/devdgras*##/dev/termdgras*##/dev/cuadgras*##/dev/DIGIrasdgras*##/dev/DIGIrasb##p##/dev/DIGIrasdgras*##/devdgras*##/dev/DIGIrasdgras*##/dev/DIGIrasb##p##/devices/pseudo/devdgras*##,ttydgras*##m/devices/pseudo/devdgras*##,cudgras*##s/devices/pseudo/devdgras*##,lpdgras*##lp/dev/cuadgras*##/devices/pseudo/dev/cuadgras*##,cudgras*##/dev/termdgras*##/devices/pseudo/dev/termdgras*##,ttydgras*##/devices/pseudo/dev/DIGIrasdgras*##,ttydgras*##m/devices/pseudo/dev/DIGIrasdgras*##,cudgras*##s/devices/pseudo/dev/DIGIrasdgras*##,lpdgras*##lp/devices/pseudo/dev/DIGIrasdgras*##,ttydgras*##m/devices/pseudo/dev/DIGIrasdgras*##,cudgras*##s/devices/pseudo/dev/DIGIrasdgras*##,lpdgras*##lpx t       ( , 0pt(Hp"$CJ0V( a krd@(  t   d`$ "p8 E" MTY8  uL|pX8 T  l( `! $ @h" >G!Nthyo, " ! p( 4H8 /export/home/dickl/sol_dense/downld/sparc/digiras_update_devlinkscrti.s_ex_shared0_ex_range0_ex_text0crt1.s__crt_scratchvalues-Xa.cdigiras_update_devlinks.ccrtn.s_ex_shared1_ex_range1_ex_text1convert_to_oldstyle_device_start_START_atoi_environ_end_ex_registerreaddir_GLOBAL_OFFSET_TABLE_find_pattern__ctypeatexitexitdigiras_create_device_linksaccesssprintfsymlinkopendir_initdigiras_create_oldstyle_device_linksgetuid___Argv_END_strncpy_DYNAMICprintf_exit_ex_deregisterenvironerrnounlink__cg92_useddigiras_remove_device_linksclosedir_edata_PROCEDURE_LINKAGE_TABLE___fsr_init_valuestrcpy_etext_lib_version_ctypemainreadlinkstrlenstrstr__environ_lock_fini<z4*cg: WorkShop Compilers 5.0 dev 28 Mar 1998 Build PUT_BUILDNUMBER_HERE@(#)stdlib.h 1.44 98/01/22 SMI@(#)feature_tests.h 1.17 97/12/04 SMI@(#)isa_defs.h 1.15 97/11/22 SMI@(#)stdio.h 1.69 98/07/13 SMI@(#)va_list.h 1.11 97/11/22 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.7 98/04/17 SMI@(#)unistd.h 1.55 98/04/14 SMI@(#)types.h 1.63 98/04/28 SMI@(#)machtypes.h 1.12 96/08/01 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.62 98/02/04 SMI@(#)time.h 1.36 98/03/27 SMI@(#)time_impl.h 1.3 98/02/13 SMI@(#)unistd.h 1.36 98/07/16 SMI@(#)dirent.h 1.28 97/04/19 SMI@(#)dirent.h 1.31 97/04/19 SMI@(#)errno.h 1.15 98/03/02 SMI@(#)errno.h 1.19 98/01/14 SMI@(#)string.h 1.22 97/12/22 SMI@(#)ctype.h 1.30 98/01/16 SMIacomp: WorkShop Compilers 5.0 dev 28 Mar 1998 C 5.0 dev Build PUT_BUILDNUMBER_HEREld: Software Generation Utilities - Solaris/ELF (3.0).interp.hash.dynsym.dynstr.SUNW_version.rela.ex_shared.rela.bss.rela.plt.text.init.fini.exception_ranges.rodata.rodata1.got.plt.dynamic.ex_shared.data.data1.bss.symtab.strtab.stab.index.comment.shstrtab.stab.indexstrdigiras_update_devlinks.cXa ; O ; V=3.1 ; R=WorkShop Compilers 5.0 dev 28 Mar 1998 C 5.0 dev Build PUT_BUILDNUMBER_HERE/export/home/dickl/sol_dense; /usr/bintools/cc -O -DSOLARIS -Dsparc -erroff=E_WHITE_SPACE_IN_DIRECTIVE -xCC -DSOLARIS7 -I/export/home/dickl/sol_dense/include -I/export/home/dickl/sol_dense/release/fepincl -I/export/home/dickl/sol_dense/libdxb -I/export/home/dickl/sol_dense/triboot -U_KERNEL -c /export/home/dickl/sol_dense/downld/digiras_update_devlinks.c -W0,-xpmain  xxo t t -  =  G  Q (W8]8c((u,,}00?pptt  (( HH(pp"""-'*l0 *.#/070701000d2af3000081a40000023d00000064000000013d2f24ed000075dc000000200000000700000000000000000000001b00000003root/opt/DIGIras/bin/dittyELFx4q|4 (44KKKK MTMT/usr/lib/ld.so.1a{CJh$bcs+zdxgOm34%r]_fZ<9P^vF"w;*qje n\MHS#a[KutR.oEBWTNliyk/('27!5:?GA@VY-,D1XIU)0=>8QpL6`&` x C$ C\ C C CKKMTNN(T U8SS$x +S;LH@0X  FU8 LSUN@^ZcQ|jLoYH@!t KLUDV XM,KKM8XYSL$LTYC$8 Y$ L MDSL"| *L2Y<6S=SLS|@RY@WNL_LdLlMTuM }YH@LSK<   N@!LZZSSNHLSLlL`!S(8 0L7L>SEZKZQU8XKrLxy` H< MMQ \KC LZSV !0d L<L0N(SC\8 NPLdigi_gedelay_namedigi_tcxonc_name_startdigi_gpoll_nameatoicatchflushloopback_environ_endfbaud_fork_iob_ex_register_GLOBAL_OFFSET_TABLE_sleepparm__ctypetcxoncsignalatexitexitalarmmodem0modem1reset_the_portaccesssprintfrport_name_initdigifputcduppreset.mulstprinttgetstrttymynamedigi_geta_namefbaudterm___Argvwaitstrncpy_DYNAMICstrncmp__iobioctlparallel_exitdxb_resetgetcode_ex_deregisterenvironperrorsendbreakerrnoarbbauddigi_spoll_name__cg92_usedtgetentdigi_sedelay_namecloseopenedelaydigigetstrcmpsystempwidthflag0flag1_edata_PROCEDURE_LINKAGE_TABLE_memsetdittydigiset__fsr_init_valueexecvpstrcpysbaud_etext_lib_versionfflushprintnparm_ctypemainstrlenstrstr__environ_lockntty_finiterm_typefprintflibcurses.so.1SUNWprivate_1.1libc.so.1SISCD_2.3libcurses.so.1libc.so.1 Nq(8ztBNQN)YHKV-K0K1KNLLL ;LzL$6L0uL<tLH LT7L`\Ll[LxfL+L_LHLYL@L>LSL'LGLoL`MjMkM JM,/M82MD< @D"bL, @'$@+`-` `?-)"D- =--% # @MP@M#\@ @@M@M㿐' $''@M'㿐'''@M'llllllllll   H` ``\`^"*H`/!)  *) H`` 0`5(`E@ @ K 0  `0 +` @ 2K   H``Ȃ ) Ĉ 㿠` N $ NNX@MN NXP@M :` (Q@K```$Q@J 87 " @J? Q@K?``&  ; " `@JӔ? @Ḱ?``&  @J ?Q@J?.+ #'H`'8# '<H8'@@J'D?Q@J̐?`'8'<8'@@J'D?Q@Jȁ? '8'< '@H'D8 'H@Js?1Q@Jԁ?1!Ő?@JЁ?"!!&!!'8'< '@H'D8!'H@JD?Q@Jq?#쀠`#쀠``'8'< '@8'D@J& @JSԁ?'8 '<8'@'D@J @J;؁?䀠1@J2 D? @J @J+?  @J&1@J! 1"#   ! Z?@IЁ?"8(07┅(0(07"  7 "  7 "  7 "   &  @I/ "      @I/@I.@I ?@Iȁ?#Ā?"#e@I] ?Q@I#Ā?"#d@IJ ?Q@Iw (1`'8'< 8'@'D@I388`@I' 1Q@IT<1hQ1@IP#"3c􀠠" @I ?Q@I; c@H7䀢? Q@I*  #`J?`̒@H?Q@I `!XQ@HВ`И` G``P#lGlXQ B#hh#d@Hd@H?"#Ȁ!  + - @ + -  + -  + - +#\ -#\Q@H΀  `` ` `$ `(`, `0`4 `8`<`@#\#\`D#`Q@Ha@H `?``'8 '<8'@'D@HA? | "` `$ !8 8   * 088 (2 |* | "` `$ @H?Q@H<8? @H?Q@H0@? !XQ@GHQ@GP&Q@G\@G.Ő.Q@GdQh@G.`|'6!882`@G6 '  @( '!"      Q@G  Q@GQ@GQ@G  $Q@G}  @ ( ,  0 4  8 <  @ D H#\ L#\Q @G\؀`1XR@GT '8 '<'@H'D"2 8@G=?+`H   + -  + - @ + -! + -  + - +#\#\ - #`XR@G`XR@G<@GDX"2"R@G@@"R@G9L Q@G5DQ@G#@F  㿠㿈`$ R\4D  <5 @F  R`@F 0Rd@F  R`@F 0Rl@Fϐ  R`@F 0Rt@FR"3` ( 2R@Fʒ|R@FR*` (!2R@FR@F  R`  @R@FxR@F^ `  ` (o R@F\R@FV RR [ @FI R R@F?I R@F6> R@F+3 R@F ( R@F R@F  R@E R@E R@E R @Eސ@ R@EӐ@ R @EȐ R(@E R4@E  R<@E  RH@E8 8RP@E< <R\@E@ @Rd@E{ Rl@Epx Rt@Eem R@EZb R@EOW R@EDL R@E9A R@E.6 R@E#+ R@E R@E  R@E R@D R@D R@Dߐ R@DԐR@DΐR@DȐ &  R @D &  R@D &  R@D &  R$@D &  R,@DR0@DR4@D}R8@DwzR<@DqmR@@DkgRD@DeaRH@D_\ RL@DXU RP@DQMRT@DKARX@DE;R\@D?/R`@D9)Rd@D3 &  : Rh@D' &  . Rl@DRp@DRt@DRx@D R|@DR@CR@CR@CR@CR@CR@CߐR@CِR@CӐR@C͐R@Cǐ &  R@C  R@CR`H0&`H9`@C  R@C#耠#("#` '` R@C 9R@C 2R@C +R@C %R@C R@C~ R@Cv  #䀠d#"#(T #耠#'`"#(H  &  B  &  <  &  6  &  0  &  *  &  $  &    &    &    &   &   &  `& @1  #耠L aX@C #耠Z<  O / Rh@B ??@B @B @Bܐ "  "@B"hRp@B@B @BŐ@B 耠XR@Bh 耦& hR@BW@BI hR@@BM@B? hR@BC@B5 㿠@ ?㿠@ ?\%03oUnable to access %s dgrasdgrasDIGIras/bDIGIras/bterm/bterm/bcua/bcua/bInvalid or unrecognized device: %s %s0Failed to open default mgmt device: %s Failed to send DGDXB_INFO_INSTANCE_TO_BOARD ioctl: errno=%i %s%uFailed to open mgmt device: %s Failed to send getset_serial_ext_config ioctl (errno = 0x%x). Reset/Clear executed successfully on %s No printer on/off strings for term %s in terminfo. %s: invalid terminal type: %s %s: valid terminal types are: %s TCFLSHTCSBRKTIOCMBICTIOCMBISTIOCMBICTIOCMBIS/bin/stty/bin/sttyioctl TIOCSMLB (tIOC|101)ioctl TIOCCMLB (tIOC|100)ioctl(DIGI_SETBAUD)ERROR: This device does not support arbitrary baudrates. TCGETATCSETATCGETAparallel %sput port pulse width %.1f us %snoack %shupcl BUSY%c IPO%c IP1%c IP2%c OP%c %sopost %solcuc %sonlcr %socrnl %sonocr %sonlret TCGETATCGETSonstr offstr term maxcps %d maxchar %d bufsize %d %sforcedcd %saltpin %sfastbaud (%d) %sprinter edelay (%d) eia%s %srtspace %sdtrpace %sctspace %sdsrpace %sdcdpace DTR%c RTS%c CTS%c CD%c DSR%c RI%c /bin/stty/bin/stty -amaxcpsmaxcharbufsizeonstrunknownoffstrunknowntermcspeedclear-clearloopback-loopback-dtrdtr-rtsrtsrtspace-rtspacectspace-ctspacedtrpace-dtrpacedsrpace-dsrpacedcdpace-dcdpaceflushinflushoutflushbreakstopoutstartoutstopinstartinfastbaud-fastbaudprinter-printereia422eia232forcedcd-forcedcdaltpin-altpin-p-paralleloutputinputnoack-noackreset-OP-opOP-op-OPop+OP+opOP+op+0.8.81.01.1.21.62.023.034.0410.01020.02030.03040.04050.0-aedelay-n%s: too many tty devices given! /dev/dty/dpr/term/ttycupr%s: too many tty devices given! %s: too many stty parameters given! /dev/%s%s: another process waiting on open ####### %s MT00<0H0T0`0l0x00000000000000 0,080D0P0\0h0t0000L[ C$ C\oo  }` oKt ladm31d#ansidg200F?3F?2dg210F?3F?2hz1500d#mc5d#microtermmultitermd#pcterm`atvi`avp-a234vp-6034vt52WXvt100vt220wang2x36wyse30wyse50wyse60d#wyse752Kn,X `%K,X%,8@p,X `%K%K8@,p `%K%,8@p,pp `%K%,8@,pp%K%2Kn,X `%K%,8@,Xp `%KF,8@,Xp `%K,X `%K,,X `%KT TT T,T<TLTXȖd2 dittyDIGI_TCXONCDIGI_GETADIGI_SEDELAYDIGI_GEDELAYDIGI_SPOLLDIGI_GPOLL/dev/DIGIras/mgmt/dev/DIGIras/mgmtpopfsttyinout------------422232-----134` x C$ C\ C C CKKMTNN(T U8Z07N CC Nx X_NDmyz{SNC C$ SSx SLH0X  U8 S N@ZQ|"L'YH@!, 9KOLUUDZV bXiM,pKwK|M8XYSL$LTYC$8 Y$L MDSL| LY<SSS|@ Y@NLL"L*MT3M ;YH@ALGSPKV< ` h wN@!LZZSSNHLSLlL`S8 LLSZ ZU8K0Lx7` =H< EVM]MdQ \jKqC ~LZSV !0d L<L0N(SC\8 NPL/export/home/dickl/sol_dense/ditty/sparc/dittycrti.s_ex_shared0_ex_range0_ex_text0crt1.s__crt_scratchvalues-Xa.cditty.cpbaudcrtn.s_ex_shared1_ex_range1_ex_text1digi_gedelay_namedigi_tcxonc_name_startdigi_gpoll_name_START_atoicatchflushloopback_environ_endfbaud_fork_iob_ex_register_GLOBAL_OFFSET_TABLE_sleepparm__ctypetcxoncsignalatexitexitalarmmodem0modem1reset_the_portaccesssprintfrport_name_initdigifputcduppreset.mulstprinttgetstrttymynamedigi_geta_namefbaudterm___Argv_END_waitstrncpy_DYNAMICstrncmp__iobioctlparallel_exitdxb_resetgetcode_ex_deregisterenvironperrorsendbreakerrnoarbbauddigi_spoll_name__cg92_usedtgetentdigi_sedelay_namecloseopenedelaydigigetstrcmpsystempwidthflag0flag1_edata_PROCEDURE_LINKAGE_TABLE_memsetdittydigiset__fsr_init_valueexecvpstrcpysbaud_etext_lib_versionfflushprintnparm_ctypemainstrlenstrstr__environ_lockntty_finiterm_typefprintf. <h4)*cg: WorkShop Compilers 5.0 dev 28 Mar 1998 Build PUT_BUILDNUMBER_HERE@(#)ditty.c 1.37 99/05/07$Header: /cvs_tick/sol_dense/ditty/ditty.c,v 1.8 2001/02/12 18:30:27 kurte Exp $@(#)stdio.h 1.69 98/07/13 SMI@(#)feature_tests.h 1.17 97/12/04 SMI@(#)isa_defs.h 1.15 97/11/22 SMI@(#)va_list.h 1.11 97/11/22 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.7 98/04/17 SMI@(#)unistd.h 1.55 98/04/14 SMI@(#)types.h 1.63 98/04/28 SMI@(#)machtypes.h 1.12 96/08/01 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.62 98/02/04 SMI@(#)time.h 1.36 98/03/27 SMI@(#)time_impl.h 1.3 98/02/13 SMI@(#)unistd.h 1.36 98/07/16 SMI@(#)stdlib.h 1.44 98/01/22 SMI@(#)errno.h 1.15 98/03/02 SMI@(#)errno.h 1.19 98/01/14 SMI@(#)string.h 1.22 97/12/22 SMI@(#)conf.h 1.57 98/01/06 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.19 98/04/14 SMI@(#)param.h 1.63 98/06/03 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.10 98/02/18 SMI@(#)stream.h 1.79 98/06/11 SMI@(#)vnode.h 1.80 98/08/03 SMI@(#)cred.h 1.21 97/01/09 SMI@(#)uio.h 1.29 97/06/29 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)seg_enum.h 1.3 95/12/22 SMI@(#)poll.h 1.26 98/06/12 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.20 97/09/22 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)fcntl.h 1.44 98/06/04 SMI@(#)stropts.h 1.44 98/04/28 SMI@(#)xxy_defs.h 1.34 99/04/07$Header: /cvs_tick/sol_dense/ditty/xxy_defs.h,v 1.4 2000/01/10 21:24:47 emillan Exp $@(#)ioctl.h 1.9 92/07/14 SMI@(#)eucioctl.h 1.10 93/11/01 SMI@(#)systm.h 1.93 98/06/03 SMI@(#)proc.h 1.117 98/03/19 SMI@(#)thread.h 1.89 98/06/07 SMI@(#)klwp.h 1.34 98/01/06 SMI@(#)signal.h 1.53 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.14 98/02/05 SMI@(#)pcb.h 1.30 98/01/06 SMI@(#)regset.h 1.23 98/03/09 SMI@(#)privregs.h 1.4 96/10/27 SMI@(#)psr.h 1.3 96/09/12 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)msacct.h 1.7 93/07/13 SMI@(#)ucontext.h 1.25 97/09/28 SMI@(#)lwp.h 1.30 98/01/06 SMI@(#)synch.h 1.35 98/06/05 SMI@(#)user.h 1.56 98/06/30 SMI@(#)timer.h 1.16 98/01/06 SMI@(#)watchpoint.h 1.6 98/01/06 SMI@(#)copyops.h 1.3 97/07/07 SMI@(#)dditypes.h 1.26 98/03/04 SMI@(#)sysmacros.h 1.35 98/06/03 SMI@(#)termio.h 1.11 96/02/07 SMI@(#)termios.h 1.38 98/02/20 SMI@(#)ttydev.h 1.7 92/07/14 SMI@(#)termiox.h 1.9 92/07/14 SMI@(#)stermio.h 1.8 92/07/14 SMI@(#)strtty.h 1.11 98/01/06 SMI@(#)buf.h 1.43 98/07/14 SMI@(#)types32.h 1.4 98/02/13 SMI@(#)kstat.h 1.14 98/01/06 SMI@(#)stdigi.h 1.23 99/04/05$Header: /cvs_tick/sol_dense/include/stdigi.h,v 1.5 2000/02/16 16:00:09 emillan Exp $@(#)signal.h 1.37 98/01/17 SMI@(#)procset.h 1.18 98/06/30 SMI@(#)curses.h 1.29 98/07/16 SMI@(#)widec.h 1.17 96/03/20 SMI@(#)euc.h 1.8 96/06/26 SMI@(#)euc.h 1.11 93/02/01 SMI@(#)wchar.h 1.31 98/05/04 SMI@(#)wchar_impl.h 1.2 98/02/27 SMI@(#)ctype.h 1.30 98/01/16 SMI@(#)stddef.h 1.15 97/12/22 SMI@(#)unctrl.h 1.7 93/02/04 SMI@(#)term.h 1.19 97/08/22 SMIacomp: WorkShop Compilers 5.0 dev 28 Mar 1998 C 5.0 dev Build PUT_BUILDNUMBER_HEREld: Software Generation Utilities - Solaris/ELF (3.0).interp.hash.dynsym.dynstr.SUNW_version.rela.ex_shared.rela.bss.rela.plt.text.init.fini.exception_ranges.rodata.rodata1.got.plt.dynamic.ex_shared.data.data1.bss.symtab.strtab.stab.index.comment.shstrtab.stab.indexstrditty.cXa ; O ; V=3.1 ; R=WorkShop Compilers 5.0 dev 28 Mar 1998 C 5.0 dev Build PUT_BUILDNUMBER_HERE/export/home/dickl/sol_dense; /usr/bintools/cc -O -DSOLARIS -Dsparc -erroff=E_WHITE_SPACE_IN_DIRECTIVE -xCC -DSOLARIS7 -I/export/home/dickl/sol_dense/include -I/export/home/dickl/sol_dense/release/fepincl -I/export/home/dickl/sol_dense/libdxb -I/export/home/dickl/sol_dense/triboot -DSOL -DDIGIRAS -U_KERNEL -I/export/home/dickl/sol_dense/dgdxb -I/export/home/dickl/sol_dense/include -ltermcap -c /export/home/dickl/sol_dense/ditty/ditty.c -W0,-xpmain x ``  }o@- = Gt Qxx.WC$C$8]C\C\8cCCuCC}CC KKKK MTMTNN N(N(T T ,U8U8dU8.^a0 b HnXoL.070701000d2af4000081a40000023d00000064000000013d2f251400013590000000200000000700000000000000000000001e00000003root/opt/DIGIras/bin/dm_adminELF5414 (44!)  /usr/lib/ld.so.1D"R<brw0?qOKik}s\.v4Va)!x8]Z{3mJyhpoY5[jA _SClc#9G6EP;QBLTn7H'X2^@>:/$+gM1I*FNuz&`Wd,f=e(t%-U~|T4<4\4t45 ȴ  $ ( ,  x **@ dP ) /x E5 Li4 `  xPL Xh @ M`  ( \      T  %tt 6 HE hW c tl w$ T 2 p  T  ,QP fh Y( -@!  x  &<L Mw(< d`` z j<H P 6 *   P lL P  \L / 08<L J|h UX$ j`T T` ,@fH x <@ k   < L(vpD 8 Eg0t ]v8 tȴ8 zdL   `wL   `  <P  f4L #l< 7 Ih< _L r } b X FX   T-$-(8` d   g8 "d4 9 G-`8Vel hut xuX v<  6p  8b  `$   $ <-@ + H2 @< lBHx T 0c 0 m y h< wd<  lX XX  Od   !J * 1.7(P PP g\ xLP  .\18lt  @O0 [D uh<    $ # `p -P\ ?  DT Z1 aG4 jg< }d8  wL  <P   T0 L   1   @ X 0hT< L L ]*} d ~y  x L  x     T  D  X  (  "  -( :el Q | \  gP |* ! |d4 h< M  4  QH 1x L P |d %  /  624@ =` P  _  i  s P }GdX 8 2t f      ` ` X`  P )x88 >Lld P4` spidnfas_master_portvalidate_clockingqueryvalidate_jitter_atten_startprint_serial_configvalidate_short_haul_lends1_eq_gain_limitprint_ds1_ext_statusprocess_queriesds1_lbo_stringaddress_typeframingvalidate_e1_settingsdchanstrtoulvalidate_country_codevalidate_busy_sigstrtoldump_serial_infobri_msn_optionnfas_interface_ide1r2_switchloopbackmodem_stattei_readabletoupper_environ_endcodinghangupvalidate_answer_sigsubaddress_typebri_switch_type_stringprint_adapter_statenum_to_switch_iob_ex_registerclockingbchan_GLOBAL_OFFSET_TABLE_validate_min_anidump_london_bri_statusprint_ds1_e1r2_configconfig_modemprint_serial_ext_statusvalidate_numberlong_usage__ctypeconfig_dchanxjitter_attenconfig_serialvalidate_send_anivalidate_spidatexitexitvalidate_incoming_allowstrerrorvalidate_min_dnisModemResetprint_ds1_ext_configvalidate_congest_sigvalidate_nfas_master_portsub_addressprint_bri_statusvalidate_long_haul_lbovalidate_t1_settingsoptoptprint_serial_ext_configserial_configsprintfbri_alert_optiondump_modem_infoconfig_errorprint_modem_nationalitydump_modem_nationality_initprint_dchan_ext_configmsa_switch.umuldump_houston_port_e1r2_configboardresetvalidate_numbering_planchannelvalidate_bri_msn_optionconfig_callprint_bchan_statusprint_serial_statuse1r2_print_configdump_dchan_ext_configds1_framing_stringboard2listchas83_ccprint_bri_configvalidate_modem_lockdisplay_cclong_haul_lbo__getopt_initializedds1_confignum_to_method___Argvgetenvflat_channeldump_adapter_stateprint_modem_ext_configconfig_ds1_r2cur_ds1_configprint_hdlc_statusdump_bchan_infodump_serial_configdump_houston_port_ext_status_DYNAMICusagedir_countprint_ds1_e1r2_config_stringstrncmpsig_stringconfig_briprintfswitch_type__iobvalidate_e1r2_sw_typestrcatchas81_ccioctlvalidate_loopbacknumbering_planchas43_ccconfig_ds1xport_typedump_dchan_infodump_houston_port_ext_config_exitif_typevalidate_if_typevalidate_back2backchas82_ccds1_clocking_string_ex_deregisterenvironprint_adapter_infoperrorerrnovalidate_subaddress_typevalidate_eq_gain_limitvalidate_cd_bitsvalidate_sub_address__cg92_usedbri_configds1_e1r2_configvalidate_bri_settingsleased_maskds1_signalling_stringoptindswitch_to_numget_serial_configcloseback2backcc_2_nameds1_jitter_stringopenvalidate_end_dnis_sigoptargstrboarddump_houston_port_infoquery_actionvalidate_pri_settingsdump_houston_port_e1r2_config_stringchas80_ccportprint_ds1_statusvalidate_max_dnisstrcmpdchan_configopterrchas41_ccvalidate_codingdump_london_port_bri_configvalidate_max_ani_edata_PROCEDURE_LINKAGE_TABLE_validate_dchan_configmemsetvalidate_nfas_interface_id__fsr_init_valuevalidate_framingserialstrcpyvalidate_ani_sigmodem_lockshort_haul_lenchas42_cc_etextconfig_xri_lib_versionprint_dchan_ext_statustx_specialconfig_ds1validate_wink_digits_ctypePrepModemConfigdump_houston_port_statusds1_length_stringcountry_codemainprint_ds1_configinfovalidate_adapter_country_codevalidate_group2_typeModemHangupconfig_e1strlennumbervalidate_r2_method__environ_lockconfig_t1config_t2chas40_ccdm_ioctl_fail_finids1_ext_configprint_bchan_ext_statusquery_callwink_digitseq_gain_limitvalidate_address_typevalidate_switch_typefprintfvalidate_bri_alert_optionvalidate_ds1x_configds1_coding_stringvalidate_tx_speciallibc.so.1SISCD_2.3libc.so.1 dzt n | xB-1*MST    $ 0V <c H T7 `l l x ,   /   @D"b, @'$+`-` `?-)¨"- =--% # @tr@t @$@Q@t@tːara,@tːasa܂@tJ  H  H2H  bb`Ѐ@$=ŀ$:Ř  @@$!+ !(  `" @&!! `$+  +` " &#@ @ Ҁ@b ℈ Ё b㿠   t@t("bN-  ⌁N+ b ʄ  ⌁㿘̢#\ ŲЀ$` &`˄  $ʰ H ʴ`ʶ $``&``&22`" ``"`< `"``&`6``(H-2 ``(H2 ``&``&``&`"%``(@t@s2``&`" `" &2&`&&&``2 `"º??&`(@H-`(@H   `(@H-  ``( @& "+ `(@H-`"" `(@H  `(@H2  #`  ?J J =  L L =2  !   $@s2@s $ 2   #``2 ` Ԁ `(@ːt@r`@r   ?& `&` ؁ "z\`&`L "5   Z Ԁ`(@H- ː`t@r `(@H`t@r @r  ń&   ? ؁+` `&`(@ Ԁ `(@ːt @rt`@r~  ń&  L:º ? :@ro  `& 2%` "      `(@H-  H2, Ԁ`(@H- ː tH@r0``(@H th@r#`Ʉ`0& ` ?&` ؁& H H `&`6`:5J W2J J ;2J #`   H    `&`"`Ԁ ːt@q` L:3 ? :`&`(@ & J J =  L L =2  !   $@q2@q $ 2   #``2 ` Ԁ `(@ːt@q`@q   ?& `&` "\& L "   ? Ԁ `ːu @q` @qj   ?& (` `&`(@ Ԁ `(@ːu<@q;`@qE  & L: ? :@q9  `& 2%` "}      W:qJ :2  H  `&`&  & H  `&`"& `Ԁ ːud@p` L:2  ? : & `&`(@ & Ԁ ːt@p` Őt@p` غ ??` &`(@ ᤁ㿠u  @pà`ôöèäduuĐ@p@@(!       ` `*  *`0@p` `  `  ׺`u@pr؝㿠"؀ @pm"ؔːu@pU@pM u@pO@pG 㿘 i%ec `AaSbAuy cPd">qu geKf"8hu gHh"4au!kiAj",Vu k>"@Ou!<">Fu!<">?uɐ4ɐH\pɐɐɐԁɐɐɐ$ɐ8Lɐ`t@o<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<ԝ㿠u@o46u@oL    du   du`d@owwuu@oqu@omu@oi u@oe P 7#u* Ra 000u@oK00u@o@u@o<u@o8 u0@o2D㿠    ɐɐɐ㿠   Ԁ  "ɐɐɐԁ㿠     "ɐ܁ɐɐ㿠      "ɐɐɐɐ TTTTTTTHTTTTTTTTTTTTTTTTTTT< $0㿠& ɀ %+(* Sb `  ` `( `8 `D `P `` `p ` ` ` ` 㿠    ɐ܁ɐɐ㿠     "ɐɐɐ 㿠   (ɐɐ @P`p㿠&  T* a8ɐ0ɐ<ɐHɐXɐhɐxɐ㿠u@m͐PN u@mǐt uu@m u@m u@m u@m^ u@mq u@m  ( (u@m  R PE Q"D  R S"u  5 "4   3u@mn ,u@mj 0 um u@mZ   u@mR@@mNd> $u@mH裘 u@mA裸`/` " `u@m> " `u@m6 " `u@m. " `v@m& " `v@m  " `v@m @" `v@m  " `v@m( " `v@l0 " `v@l8 " `v@l@ " `v@lL " `v@lݒT " `v@lԒ\ " `v@l˒d  " `v@l’l @" `v@lt     v  "v@l v@l v@l  v@l v@l      v  "v@lvvv@lqvv@lk vv@lfvv @l` v$@lV`v0@lNv<@lG㿠 v X@l>  v @l8  v @l2 v$(@l+㿠v$@l"(4@LXdp| $0㿠& ɀ j* V` ` `  ` `$ `, `4 `@ `L `T `` `l `x ` ` ` ` ` ` ` `ȁ `ԁ ` ` ` a a a, a< aL aX a` al at \hlhhhhhhhhhxhh$㿠N "N _N` .`@kvN`.``N`2N`N A V* bvT@kMv X@kEv `@k=v l@k52? vt@k,v |@k$v @k2ߐ? v@k2֐? v@k v @kv @jv @j 2? v@jv @jv @jؐ2? v@jϐv @jǐ2? v@jv @jv @j2q? v @jv 0@jv <@j 2W? vL@jv \@j2F? vl@jzv x@jr25? !v@jiv @jav @jYv @jQv @jIv @jA? 㿠    \ʐʐ4ʐL㿠v`@j)㿐ʰdv@j``v@j`v` @j ``w `4@i` `  `$w@il `( `,w@i `0 $`@w@iՐw`4@i`8w`<@@i`Dp #h $#l (#p ,#t 0#x @# #\ #` #d 4#| 8# <# D#w |   @i 㿠w@i wȔ  @i  3cw@i"Lw@iw@i("L( w @ @itL H ww@idlL,wwx < @iVLH ww@iKLLww` $ @i=LH w   @i0PTw@i+ 㿠 w@i  w   @i㿠x@i x ,  @i 㿠 x x @i  x @h  x @h $x((,@h㿠x@hX     `؅(ʔ xp@h      `؅(ʔ$x@h  ԝ㿠x@h㿠x@h x@h x@h `x@h㿠x@h x @h  @hӅ2`2` ( ($x@h4㿠 xL@h  xp@h x@h㿠ʐ(Ô`Òd ` `*` 0  x@hb㿈@ho hȐ !@h`'Ȁx́㿐 #@hQ'@ A@hB'㿈 @h3'쀐㾘 @h$'㿠x@h    "x   "x x@g @g  x@g( @g<  "x x@g֐P  x@gѐl @g͐ xx@g‘裠x@g裼`@g㿠x@gy @g y$@g y<@g yT@g yl@g y@g y@g y@g y@g y@g $y @g (y,@g ,yH@g 0yd@g 4y|@g| 8y@gx <y@gt @yIJ@go D`Hy@gj㿠y@gf  y y@g[$  y@gVH @gRl yy@gG袄y@gD袜@gB袴4`㿠y@g8  y,y@g*yy@g% yy@g  yy@gy@g y `@g@ʰX?    8I,[`$ y??@fP8 y??@f\- y?@fh" y@f֐t y@fː  y?@fDy@f`,   y  "yyy@fyy@fyy@f y@fy@f`,y@fy@f`0 yy@fyy@fz yy@fuy@fq`0y@fny@fk`4    z"  "zzy@fUzy@fPzz@fKzz@fF  z@fBz @f=`4z@f:(`   z|  "zzz@f&,zz@f!@zz@fT z@fhz|@f`z  `@f z@f " "z@e"z@e "z@e݀zz@eސz  ` @eؐz@eՐԀ" "z@eŐ"z@e "z@e݀zz@ez  `@ez@e""z@e8"z@e@ "z@e{,ۀzz@erHz  `@elPz@eiT""z@eXx"z@eO "z@eDlۀzz@e;z@e8z@e5` z@e/`$z@e)` `$z@e#zz@e`$z@e`(z  @ez@eܝ”t̐'t @e'ĀDxĐ@e  တȁ㿠̒ @d&`t㿀Ր”̐ @d'`f”t̐'t @d'Nx@dʒ C㿈”̐ @d'쀐2㿘@d $pА $@d'Ѐ@ԁxؐ B@d'؀܁㿐 "@d~'<0 '@do'@d= 0 '@d\'&@d* 㿠1#t't'#t"##t #| #|#| xz@cZ@c z@cP@c z@cTF@cܐ  <L\l|㿠̲ @c 1 #(( 8#* ^ap &`# &`# &` # &` # &`# &`#0`0 8#* ^a &` # &` # &`  # &`  # &` # &` #,A, " „ &`&`$   "    "  &` &`&`z@c=@c3 |z@c3@c) z@c)@c 㿠 @cB & D& 㿀 @c5 ' 'z@c<@c%㿀 @c ' ''z@bX@c 㿠²Ā2 R?  p P `  p i5 q S P Q R"` S p"M  qE  " `  C`ː `˰`@b !9  2 „   &„  ?` 1F```#2#W`#`'>`J``@bQ  㿠Ԁːz@bJxa"Āː{@b5핁") Ȁ Āf ː{@b<zȀ Āk ː{@btbȀ Ā ː{@aJȀ Ā ː{@aҒ2 /1"Āː{@aÒ#  P Q   "ː `˲`@aɒ !` "L{@aL@a "1@a `{@a@a "3㿠@a ”ؖ ː{@ao 㿠@ar ”ؖ ː{0@aW 㿠@aZ ”ؖ ː{t@a? 㿠@aB  ؆ ː{@a* N  N (Òd``*` ؆ ː{@a  㿠Ò̐  ` ` *  . Ä`(Ä ` @ *`؆ ː{@`Β$.@`Đ ֘ ؕ6` Äː{d@``@` 㿠 € ؆ ː{@`  㿠 € ؆ ː{@`}  㿠  € ؆ ː|@`]  㿠 € ؆ ː|<@`?  㿠  ؆ ː|h@`+  㿠  ؆ ː|@`? 㿠  ؆ ː|@_?㿠  ؆ ː| @_  㿠  ؆ ː|@@_Ԕ  pppppp㿠&  b* a؆ ː|p@_ 㿠  ؆ ː|@_  pppppp㿠&  b* bx؆ ː|@_ 㿠  ؆ ː|@_n  㿠 € ؆ ː|4@_P  㿠&  %b* c؆ ː|`@_ 㿠  ؆ ː|@^  㿠&  c* a؆ ː|@^۔ 㿠  ؆ ː|@^Ŕ  㿠&  ؔ ː|@^  㿠  ؆ ː|\@^  㿠  ؆ ː|@^  㿠N ʆb"  @^ "  ؆ ː|@^g 㿠 " €  ؆ ː|@^K  㿠  ؆ ː}@^3  㿠 @ ؆ ː}0@^ 㿠 @ ؆ ː}X@^  㿠 @ ؆ ː}@] 㿠 @ ؆ ː}@] 㿠  ؆ ː}@]Д 㿠&   ؆ ː}@] 㿠&   ؆ ː} @] 㿠&   ؆ ː}L@] 㿠&   ؆ ː}x@]| 㿠&   ؆ ː}@]g 㿠  ؆ ː}@]W 㿠&  ؆ ː}@]@ 㿠S˰(@]S !䀠܀"   R S    @g @ &2 „    „  )쀠耠ˁː}@\(B@\ؐ ː}@\ؒp8@\Α X||||||XXh1#< &8 ‡* ea#< @#l3#l 4cT" 34dcT3 8cX" 34acX3 <c @^c D#\` `` `" #\ €`U`"T#\#\ 0#p```" #p €``"J#p#p ,#x"#x H#P"#P L#`"#` P!R!˶(( 1Ȑ 'Ȑ@\7 !# ' '   9   99    "   1€  1´ 1#d" 0"#d#d#d&00" 00ː~\@[0Ȅ19#h" 0#h&424014  141ː~@[#@" ,#@2#@#@&,,S,ː@[dh3c@ #<    c@   c@2c@c@c@2c@c@ T@     ˀ  !T  !T ː~@[@ː}@[9@[/ ː}@[0 @[& }@[&t@[ cT}@[|@[ cX~@[r@[ c#\ː~@[Lf@Z ː~@Z[@Z ~@ZQ@Z #d~@ZG@Zݐ '0~@Zݒ|=@ZӐ !#hː@Zђx1@Zǐ 7#@ː~@Zƒ&@Z ?ː~@Z@Z 83”ː~@ZL@Z Kc@ː~@Z@Z ?c@̝㿠1#< &8ˇ* gb|#< @!@&2!@„  !@ 1„  #\#\` ```"#\ #``2##\ 0#p#p`` `"#p #``#p ,#x#x"##x H#P#P"#P L#lTX`dh1@1#@ #@ 2#@#@ T@Y@Y S#<ː@YP@Y ː@Y@Y Bː@Y@Y P#\ː@Y$@Y Y#@Y\@Y{ X#pː@Yy@Yo ^#@Yo@Ye ]@Ye@Y[ d#l@YY<@YO hː@YNt@YD aː@YC@Y9 Zː@Y8@Y. Sː@Y-(@Y# Lː@Y"l@Y Eː@Yw@Y  >@Y m@Y >1”ː@Y8a@X <#@|tttttt㿠¬  #\ 䀠> 쀠:耠4܀#Đ ˸ܔ@XҒ A#K"Pc'"P#<`i*`a#<' 5@ 3@c2@@' 3cH  cH'"T#L" #L'"X   8"P* ia\ #\ "P"T   "P  "P("P'"P "P * * ˆ ˖ ˈ#c** * H HH ** ˴̸4̲8    @Ѧ  @XY  H`* !,8"!,!,ː* ( @"`H2 @!,@"!, ˸ˤ˲ʴʢ    \ `H" ,ˠ @X `" H" ,ˠ @W `HH `* ,  `˲˴* (&H@W  <  , ,ː@Wl@W #<@W@W@W{ 5”ː@Wy@W@Wm @$@WlcH@W@W` cHːd@W\@W@WP $ ː@WM@Wv@WA W@W>@Wg@W2 KP@W0@WY@W$ G ː@W!@WJ@W Eܔ@Wr@W;@W 9$@Wd@W-@V 5 ,,,,,,,,tttttttt Dd<  \ , t X t l4 t ,L @ `  $  X  H$l㾀ʐ̞4̘8˖˔' ## `"""``"   `&#Ŗ& ?"̢4ʸʶ˴˲̒'  8`zk*`a̒  @V< ̒  @V4 !!( !"t 8̒  @V# І  І  | І s І j І a І X `+"k*`Ԇ  '( (= ’"`Ԇ  ,( (* ’"`Ԇ  1( (  Ԇ  <’   Ԇ @U @’   Ԇ @Us D’   Ԇ @Ua  H’   Ԇ @UO L’   Ԇ @U= P’   Ԇ @U+ T’   Ԇ @U X’   Ԇ @Uy \’   Ԇ @Tg `’   Ԇ @TU d’   Ԇ @TC h’   Ԇ @T1 l’   Ԇ @T p’   Ԇ @T t’   Ԇ @T x’   Ԇ @Ty |’   Ԇ @Tg І   Ԇ  4’ Ԕ   @TL `’ Ԕ   @T:U P’ Ԕ    @T$] T’ Ԕ    @Tew X’ Ԕ   @Sse \ \  S ’ Ԕ    @S}= d’ Ԕ    @S' h’ Ԕ    @S| l’ Ԕ   @S $’ Ԕ   @S (’ Ԕ   @Sr ,’ Ԕ   @S` 0’ Ԕ   @SN p’ Ԕ   @S< t’ Ԕ  ܆ @S* <’ Ԕ   @S x’ Ԕ  ܆ @S"c@c@oc@j"c@’ Ԕ   @RX |’ Ԕ   @RF D’ Ԕ    @R0 ’ Ԕ   @R H’ Ԕ   @R LԆ   8LŖV ?A"&"" 6""Ȁ Ā""Ȱ |@RR| @Rl?  € @RK 1!@RA 3bĀ"b bĀ5Ȁ" Ȁ4 b@R# „  Ѐ戀@R$ ؀1"Ԁ774""b4'o$@Q"&4r&4"Ԅ &""Ԁ6 bĒ?&b@Q *ȀD@Q͐F@Q j9 c ` R Pb Q`b R[ S"ZZˀ `a a_ b"^Qˀ g e cT d"SFˀ eM f"L?ˀ gF hD i"C6ˀ   p j7 k"6)ˀ pt q"s5$"ˀ   "ˀ! !!"ˀ!!!"¶²´° ܀"$!˔(@Q/""`"̔t@Q "``" $'̔8@Q"  $̔@Q{' 205$¶²̰ ܀" `˔ܒA@P"`Y` @PӐL' 2̒Đ@PА @P @P,@P @P /@P @P 'ː@P@Py 1ː@Px@Pn 0 @P|@P@Pc <bː@P` @PV J5ːD@PT ۴@PJ H ۮ@Pw@PB X1@PBtۢ@Pk@P6 V7ː@P5ە@P+ rː@P*ۊ@P  o@P 0@PK@P tː@PP@P@@P  㿠@A?㿠@A? Configure Digi International adapters, usage: dm_admin [--help] [-b adapter] [-p port] [-c channel] [-N] [-v] [-q] [-B] [-D] [-G] [-g] [-E] [-C modem_nat] [-m busy_out] [-h] [-r] [-f framing] [-i if_type] [-l coding] [-s switch] [-t clocking] [-O decibels] [-o length] [-e eq_gain] [-w wink_digits] [-L loopback] [-M leased_mask] [-T tx_spec] [-I back2back] [-F nfas_port] [-R nfas_id] [-Y addr_type] [-y subaddr_type] [-P num_plan] [-j jitter] [--A1 dirnbr1] [--A2 dirnbr2] ... [--A8 dirnbr8] [--S1 spid1] [--S2 spid2] [--a1 subaddr1] [--a2 subaddr2] ... [--a8 subaddr8] [-x msn] [-X autoalert] [-z] [--e1r2_sw_type type] [--print_e1r2 ] [--cd_bits bits] [--r2_method method] [--max_dnis nbr ] [--min_dnis nbr] [--max_ani nbr] [--min_ani nbr ] [--send_ani send] [--ani_sig nbr] [--answer_sig nbr ] [--congest_sig nbr] [--end_dnis_sig nbr] [--busy_sig nbr ] [--sz_ack_delay mscs] [--answer_delay mscs] [--incoming_allow msk ] [--group2_type type] [--linesig_min mscs] Enter "dm_admin --help" for the long version of usage See "man dm_admin" for the most complete information Usage: dm_admin [options] Configure Digi Intl. adapters: AccelePort RAS 8 AccelePort RAS 4 AccelePort 2p PCI AccelePort 4p PCI AccelePort 8p PCI AccelePort 16p PCI Main Options: --help Display long usage text -b adapter Adapter number (0-3) [0] -p port Port Number (1-32) [none] -c channel Channel Number (1-32) [none] -N Display all Modem Nationalities Ignores -b, -p and -c -q Query adapter if -p not specified Query port if -p specified Ignores -c -G Query serial-chan status Requires -p and -c -g Query serial-chan config Requires -p and -c -E Query modem info Requires -p and -c -v Print dm_admin revision only Ignores -b, -p and -c -C modem_nat Set Modem Nationality Ignores -p and -c -m Set modem busy-out (1=DISABLE, 2=IMMEDIATE, 3=DELAYED) Requires -p and -c -h Force modem hangup Requires -p and -c -r Force modem cold reset Requires -p and -c AccelePort RAS family of adapters unique options: [default] for all is [nochange], requires -p [No unique options] AccelePort Xp family of adapters unique options: [default] for all is [nochange], requires -p and -c [No unique options] See "man dm_admin" for additional information POSIXLY_CORRECT--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: invalid option -- %c %s: option requires an argument -- %c %s: option `-W %s' is ambiguous %s: option `-W %s' doesn't allow an argument %s: option `%s' requires an argument %s: option requires an argument -- %c Digi Intl. Modem Nationalities on a per adapter basis %s: %c%c, %s ioctl to adapter failed: %s ioctl to adapter failed Unknown adapter type = 0x%xAdapter Information: Board type: %s Geographic Address: 0x%02x Ports: %d Channels/port: %d Memory size: %d bytes FEP version: %x CSC version: %c.%c%c%c Pump version: %x.%x%c Part Number: %s Main board serialid: %s Daughter card serialid: %s Port Configuration/Information: Signalling: %s (%d digits) Coding: %s Framing: %s Clock source: %s Jitter attenuation: %s leased_mask: 0x%08x NFAS port: %d NFAS ID: %d Interface: Long Haul, LBO: %s Interface: Short Haul, length: %s Interface: odd channel to even channel loopback Equalization gain limit: %s Interface: odd channel to even channel loopback LOS LFA AIS RFA LTS0MFA CREBIT FBE CRCE ECE REBIT LCRCATMX NFA SSFA BFA CMA LBFA UNDEFINEDNo AlarmRed AlarmBlue AlarmYellow AlarmUnknown Alarm (0x%x)No LoopbackPayload LoopbackLine LoopbackLocal LoopbackUnknown Loopback (0x%x) LOS: %s Alarm: %s Alarm: %s, Loopback: %s errsec: 0x%x, unavailsec: 0x%x, burstsec: 0x%x seversec: 0x%x, severfrsec: 0x%x, controlslipsec: 0x%x LOFcount: 0x%x, degradmin: 0x%x, lineerrsec: 0x%x linecodevio: 0x%x, crcerrcount: 0x%x TX special: %x, Loopback %x, Auto Config %x ITUINDIAINDONESIAISRAELABACUSARGENTINAAUSTRALIABRAZILCHINACOLUMBIACOSTA_RICACZECHEAST_EUROPEECUADOR_ITUECUADOR_LMEGREECEGUATEMALAPARAGUAYPERUPHILLIPPINESSAUDI_ARABIASINGAPORESOUTH_AFRICAMEXICO_TELMEXMEXICO_TELNORVENEZUELAVIETNAMTHAILANDURUGUAYKOREAMALAYSIANEW_ZEALANDHONG_KONG%s-%d E1 R2 configuration: Type: %s, Method: %s CD Bits: 0x%x, Min DNIS Digits: %d, Max DNIS Digits: %d Min ANI Digits: %d, Max ANI Digits: %d, Send ANI: %s ANI Next Digit Signal: %s, Group B Answer Signal: %s Congestion Signal: %s, End of DNIS Digits Signal: %s Busy Signal: %s, Group II Outgoing Signal: %s Seize Ack Delay: %d ms, Answer Delay: %d ms Incoming Type Mask: 0x%x, Line Signal Min Time: %d ms --e1r2_sw_type=%d --cd_bits=0x%x --r2_method=%d --min_dnis=%d \ --max_dnis=%d --min_ani=%d --max_ani=%d --send_ani=%d \ --ani_sig=%d --answer_sig=%d --congest_sig=%d --end_dnis_sig=%d\ --busy_sig=%d --sz_ack_delay=%d --answer_delay=%d \ --incoming_allow=0x%x --group2_type=%d --linesig_min=%d Port Configuration/Information: Switch type: %s, Autospid (off=%d, on=%d): %d Leased mask: 0x%x Directory count: 0x%x Directory Numbers: %1d: %s Sub-Addresses: %1d: %s SPIDs: %1d: %s MSN (off=%d, on=%d): %d AUTOALERT (off=%d, on=%d): %d Dchannel Mode: %x Dchannel Mode: %x, Addr Type: %x, Num plan: %x, Subaddr type: %x Modem Information: Busy-out: %x, Leased line: %x, Tx Audio Level: %x, Rx Audio Level: %x TX bytes: %d, RX bytes: %d, TX frames: %d, RX frames: %d RX bad frames: %d, RX short frames: %d, RX long frames: %d RX aborts: %d, RX overruns: %d, RX crc err: %d RX buffer overflows: %d, TX underruns: %d D-Channel Information: tei state[0]: %d (%s) tei state[1]: %d (%s) B-Channel Information: Tx rate: %d CPS Rx rate: %d CPS Connect time: %d Connect rate: %d Memory usage: %d %% CPU usage: %d %% Uptime: %d.%d secs Power: %x activation state: %x rx_info_state: %x tx_info_state : %x loss of sync: %d collisions : %d Modem Nationality: %c%c (%s, 0x%x) Serial Configuration: Line Type: RS232 Line Type: RS422 Line Type: RS423 Line Type: V35 Clock Source: Internal Clock Source: External Clock Source: Split Alt Pin: RJ-45 (disabled) Alt Pin: Swap DCD & DSR (enabled) Alt Pin: %x Serial Extended Status: Transmit Bytes: %d Receive Bytes: %d Transmit Frames: %d Receive Frames: %d Receive Bad Frames: %d Receive Short Frames: %d Receive Long Frames: %d Receive Aborts: %d Receive Overruns: %d Receive CRC Errors: %d Receive Buffer Overflows: %d Transmit Underruns: %d Interrupted Frames: %d Breaks Recieved: %d Parity Errors: %d Framing Errors: %d Overrun Errors: %d TX Async Ctrl Char Map: %d RX Async Ctrl Char Map: %d Serial Extended Configuration: UNPAUSE_RX: XON/raised RTS = 0 UNPAUSE_RX: XON/raised RTS = 1 UNPAUSE_RX: UNKNOWN UNPAUSE_TX: XOFF = 0 UNPAUSE_TX: XOFF = 1 UNPAUSE_TX: UNKNOWN ? Serial Status: Line State: Closed Line State: Open/Active Line State: Active Line State: 0x%x RTS: %s CTS: %s DTR: %s DSR: %s RI: %s DCD: %s Data Bits: 8 7 6 5 %d Stop Bits: 1 2 One and One Half %d Parity: None Odd Even Space Mark %d Frame Mode: None Frame Mode: SLIP Frame Mode: PPP Frame Mode: HDLC Frame Mode: 0x%x Input Flow Control: XON/XOFF RTS DTR None Output Flow Control: XON/XOFF CTS DSR None Input Flow Asserted: XON/XOFF RTS DTR None Output Flow Asserted: XON/XOFF CTS DSR None Input/Output Speed: Unknown/%d/Unknown%d Autobaud: %s dm_admin: loopback is not valid if switch type is MSA dm_admin: loopback is not valid if switch type is E1 R2 dm_admin: tx_special is not valid if switch type is MSA dm_admin: addr_type is not valid if switch type is MSA dm_admin: num_plan is not valid if switch type is MSA dm_admin: subaddr_type is not valid if switch type is MSA Applying modem hangup... Applying cold modem reset... dm_admin: Query-type commands (-q, B, D, E, g, G, --print_e1r2) cannot be mixed with configuration change options! Change options are being ignored dm_admin: port (-p) required with -D dm_admin: port (-p) and channel (-c) required with -B dm_admin: port (-p) and channel (-c) required with -E dm_admin: port (-p) and channel (-c) required with -G dm_admin: port (-p) and channel (-c) required with -g dm_admin: port (-p) required with --print_e1r2 dm_admin: Attempting to display E1 only information on a non-E1 adapter, invalid dm_admin: --print_e1r2 valid only if switch type (-s) is E1 R2 (12) dm_admin: directory number (--A%d %s) is too long, max length is %d! dm_admin: sub-address (--s%d %s) is too long, max length is %d! dm_admin: spid (--S%d %s) is too long, max length is %d! dm_admin: Modem nationality="%s" invalid, must be 2 chars dm_admin: Modem nationality="%s" is not suppoerted dm_admin: Unknkown adapter, unable to set modem nationality dm_admin: Modem Nationality="%c%c" not supported by %s adapter dm_admin: jitter (-j) = %d is invalid! dm_admin: long haul level (-O) = %d is invalid! dm_admin: short haul length (-o) = %d is invalid! dm_admin: framing (-f) = %d is invalid! dm_admin: eq_gain (-e) = %d is invalid! dm_admin: NFAS master port (-F) = %d is invalid! dm_admin: NFAS interface ID (-R) = %d is invalid! Must be 0 - 127 dm_admin: interface type (-i) = %d is invalid! dm_admin: back-to-back (-I) = %d is invalid! dm_admin: address type (-Y) = %d is invalid! dm_admin: subaddress type (-y) = %d is invalid! dm_admin: numbering plan (-P) = %d is invalid! dm_admin: coding (-l) = %d is invalid! dm_admin: loopback (-L) = %d is invalid! dm_admin: switch (-s) = %d is invalid! dm_admin: clocking (-t) = %d is invalid! dm_admin: tx special (-T) = %d is invalid! dm_admin: modem busy-out (-m) = %d is invalid! dm_admin: wink digits (-w) = %d is invalid! Must be 1 - %d dm_admin: msn (-x) = %d is invalid! dm_admin: autoalert (-X) = %d is invalid! dm_admin: --e1r2_sw_type = %s is invalid! dm_admin: --cd_bits = %d is invalid! dm_admin: --r2_method = %d is invalid! dm_admin: --min_dnis = %d is invalid! dm_admin: --max_dnis = %d is invalid! dm_admin: --min_ani = %d is invalid! dm_admin: --max_ani = %d is invalid! dm_admin: --send_ani = %d is invalid! dm_admin: --ani_sig = %d is invalid! dm_admin: --answer_sig = %d is invalid! dm_admin: --congest_sig = %d is invalid! dm_admin: --end_dnis_sig = %d is invalid! dm_admin: --busy_sig = %d is invalid! dm_admin: --incoming_allow = 0%x is invalid! dm_admin: --group2_type = %d is invalid! dm_admin: Attempting to set BRI only parameters on a PRI port, invaliddm_admin: Attempting to set E1 R2 only parameters when switch is not set to E1 R2, invalid dm_admin: Attempting to set E1 only switch type (-s) on a T1 adapter, invalid dm_admin: Attempting to set BRI only switch type (-s) on a T1 adapter, invalid dm_admin: Long haul decibel level (-O) valid only with if_type=Long Haul dm_admin: Short haul length (-o) valid only with if_type=Short Haul dm_admin: Wink digits (-w) valid only with switch type=Wink Start dm_admin: Framing (-f) = %d valid only for E1 adapter dm_admin: Coding (-l) = %d valid only for E1 adapter dm_admin: NFAS master port (-F) valid only for two port T1 adapter dm_admin: NFAS interface ID (-R) valid only for two port T1 adapter dm_admin: Bits 0x%08x invalid in leased mask (-M) dm_admin: Bits 0x%08x invalid in leased mask (-M) dm_admin: WARNING: Bits 0x%08x invalid in current leased mask, ignored dm_admin: NFAS master port invalid if either of the T1 ports on adapter is channelized T1 dm_admin: WARNING: NFAS master port(%d) on this port(%d) is not the same as NFAS master port(%d) on the other port(%d). NFAS will not be enabled until they are configured to be the same. dm_admin: NFAS interface id invalid if either of the T1 ports on adapter is channelized T1 dm_admin: NFAS interface id invalid if NFAS master port is disabled dm_admin: WARNING: NFAS interface id(%d) on this port(%d) is the same as NFAS interface id(%d) on the other port(%d). NFAS will not function correctly until they are unique. dm_admin: Bits 0x%08x invalid in leased mask (-M) dm_admin: WARNING: Bits 0x%08x invalid in current leased mask, ignored dm_admin: Attempting to set E1 cpci only switch type on a non-cpci adapter, invalid dm_admin: Attempting to set T1 only switch type on an E1 adapter, invalid dm_admin: Attempting to set BRI only switch type on an E1 adapter, invalid dm_admin: framing is not valid if switch type is MSA dm_admin: Framing (-f) = %d valid only for T1 adapter dm_admin: coding is not valid if switch type is MSA dm_admin: Coding (-l) = %d valid only for T1 adapter dm_admin: clocking is not valid if switch type is MSA dm_admin: jitter is not valid if switch type is MSA dm_admin: if_type = %d (-i) valid only for T1 adapter dm_admin: long_haul_lbo (-O) valid only for T1 adapter dm_admin: Short haul length (-o) valid only for T1 adapter dm_admin: Wink digits (-w) valid only for T1 adapter dm_admin: Equalization gain limit (-e) valid only for T1 adapter dm_admin: NFAS master port (-F) valid only for two port T1 adapter dm_admin: NFAS interface ID (-R) valid only for two port T1 adapter dm_admin: leased_mask is not valid if switch type is E1 R2 dm_admin: Bits 0x%08x invalid in leased mask (-M) dm_admin: Attempting to set PRI only parameters on a BRI port, invalidPRI switch type (-s %d) not valid for BRI adapter Invalid Leased Mask (-M 0x%08x), only bits 0x03 may be set msn option (-x %d) valid only for switch_type=EURODSS1 (20) Directory number option (--A%d %s) is beyond max entries (%d) for this switch type Sub-address option (--a%d %s) invalid for this switch type, spid only Sub-address option (--a%d %s) is beyond max entries (%d) for this switch type Sub-address option (--a%d %s) has no directory number, required Spid option (--S%d %s) invalid for this switch type, sub-address only Spid option (--S%d %s) is beyond max entries (%d) for this switch type Spid option (--a%d %s) has no directory number, required dm_admin: Warning, Directory Number %d is empty A1A2A3A4A5A6A7A8a1a2a3a4a5a6a7a8S1S2S3S4S5S6S7S8e1r2_sw_typecd_bitsr2_methodmin_dnismax_dnismin_animax_anisend_aniani_siganswer_sigcongest_sigend_dnis_sigbusy_sigsz_ack_delayanswer_delayincoming_allowgroup2_typelinesig_minprint_e1r2helpF:R:I:L:T:b:c:C:d:e:j:Y:y:P:o:O:f:hi:l:M:Nnp:qrs:t:vEDgSGBm:w:Z:x:X:zdm_admin - $Revision: 1.15 $ F:R:I:L:T:b:c:C:d:e:j:Y:y:P:o:O:f:hi:l:M:Nnp:qrs:t:vEDgSGBm:w:Z:x:X:zdm_admin: adapter %d out of range dm_admin: no port specified for channel %d /dev/DIGIras/dgdxb_mgmt%dCannot open device %sdm_admin: port %d out of range (1 - %d) dm_admin: channel %d out of range (1 - %d) dm_admin: No query options or configuration change options specified, Required dm_admin: port (-p) must be specified. dm_admin: channel (-c) must be specified with -m, -h, or -r. dm_admin: Unknown adapter typedm_admin: Invalid configuration option for this adapter type 00<0H0T0`0l0x00000000000000 0,0 x ȴ o4&2 echo "ERROR: dm_gui directory not found." >&2 exit 1 fi if [ \! -x ${TIXWISH_PATH} ] then echo "ERROR: dm_gui not properly installed." >&2 echo "ERROR: tixwish not found." >&2 exit 1 fi TCL_LIBRARY=${GUI_DIR}/tcl/lib/tcl8.0 TK_LIBRARY=${GUI_DIR}/tcl/lib/tk8.0 LD_LIBRARY_PATH=${GUI_DIR}/tcl/lib export LD_LIBRARY_PATH ${TIXWISH_PATH} ${GUI_DIR}/dm_gui.tcl 070701000d2af6000081a40000023d00000064000000013d2f2516000094f0000000200000000700000000000000000000002000000003root/opt/DIGIras/bin/dm_portregELFh44 (44^2^2^4^4__/usr/lib/ld.so.1SnJR>h=Hb2eGg:l+T#]8MO(\AmFQ_WKLiVjB5[/cD`?Yd7ZIaPNk^ '3%)",!1;$0C.S4&9<UXE@6-f*  $<h F` F F F